KEGG   Azospirillum sp. B510: AZL_d00150Help
Entry
AZL_d00150        CDS       T01169                                 

Gene name
bdh
Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
azl  Azospirillum sp. B510
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AZL_d00150 (bdh)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    AZL_d00150 (bdh)
Enzymes [BR:azl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     AZL_d00150 (bdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510d:14155..14943
Genome map
AA seq 262 aa AA seqDB search
MTTLKGNAALVTGSTSGIGLGIARQLAGQGADLMLNGFGDAAYITDLCQSLSAEFGVRVA
HNGADMSKPEEIEAMVAATQAAYGRLDVLVNNAGIQHVAPVDAFPVERWDAVIAINLSAV
FHGTRAALPGMKARGWGRIINIASVHGLVASVNKSAYVAAKHGVIGLTKVTALELAETSI
TCNAICPGWVLTPLVQKQIDALAASRGLSVEEAGRELLSEKQPSKSFVTPEQLGELAVFL
CSDAAGNMRGAALTMDGGWTAQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaccactctgaaggggaacgcggcgctcgtcaccgggtccaccagcggcatcggtctc
gggatcgcgcggcaactggcggggcagggcgccgacctgatgctgaacggcttcggcgat
gccgcctatatcacggatctgtgccagtcgctgtcggcggagttcggcgtgcgcgtcgcc
cacaacggcgccgacatgtccaagcccgaggagatcgaggcgatggtcgccgccacccag
gccgcctatggccggctcgacgtgctggtcaacaatgccggcatccagcatgtggcgccg
gtcgatgcctttccggtggagcgctgggacgcggtcatcgccatcaacctgtcggccgtc
ttccatggcacgcgtgccgccctgccggggatgaaggcgcgtggctgggggcgcatcatc
aacatcgcctcggtccatgggctggtggcctcggtcaacaagtcggcctatgtcgccgcc
aagcatggcgtgatcggcctgaccaaggtgacggcgctggaactggcggagaccagcatc
acctgcaacgccatctgcccgggttgggttttgacaccgctggtgcaaaagcagatcgat
gcgctggccgcgtcgcggggattgtcggtggaggaggccggccgcgagctgctgagcgaa
aagcaaccgtccaagtccttcgtcacgcctgaacagctgggggaactggcggtattccta
tgctccgacgcggccggcaacatgcgcggtgcggcgttgaccatggatggcggctggacc
gcccagtaa

DBGET integrated database retrieval system