KEGG   Azospirillum sp. B510: AZL_d00310Help
Entry
AZL_d00310        CDS       T01169                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
azl  Azospirillum sp. B510
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AZL_d00310 (galU)
   00052 Galactose metabolism
    AZL_d00310 (galU)
   00500 Starch and sucrose metabolism
    AZL_d00310 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    AZL_d00310 (galU)
Enzymes [BR:azl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AZL_d00310 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510d:34938..35807
Genome map
AA seq 289 aa AA seqDB search
MRKPVRKVVFPVAGLGTRFLPATKAIPKEMLPLVDRPLLQHAVEEARAAGIEDFVFVTGR
SKRAIEDHFDADTELNRTLEERGKMDALEEVRHSEIAPGRCFYTRQQVPLGLGHAVWCAR
ALIGNDPFAIVLPDDYVQGKTPCLKQMVEAYEEVGGNIVAVVDVPRERTSSYGILDVEKD
DGRLATVRGLVEKPKPAEAPSTLSIIGRYILQPEIFDHLEKQQRGAGNEIQLTDAMAKLI
GSQPFHGLRFEGTRYDCGDKVGFIEATLAHALNRPDMADKVREMLRKYC
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaacccgtgcgcaaggtggtgttcccggtcgccggtctcggcacgcgcttcctg
ccggccaccaaggccatcccgaaagagatgctgcccctggtcgaccgccccctgctgcag
cacgccgtcgaagaggcgcgcgccgccggcatcgaggatttcgttttcgtcaccggccgt
tccaagcgcgccatcgaagaccatttcgacgccgacaccgaactgaaccgcacccttgag
gagcgcggcaagatggacgcgctggaggaggtccgtcacagcgagatcgcccccggccgc
tgcttctacacccgccagcaggttccgctcggcctcggccacgccgtgtggtgcgcccgc
gccctgatcggcaacgaccccttcgccatcgtgctgcccgacgactatgtccagggcaag
accccctgcctgaagcagatggtcgaggcgtatgaggaggtcggcggcaacatcgtcgcg
gtggtcgacgtcccgcgcgagcgcaccagcagctacggcatcctcgatgtcgagaaggac
gacggccgtctcgccaccgtccgcggcctggtcgagaagcccaagccggccgaggcgccg
tcgaccctgtcgatcatcggccgctacatcctgcaaccggaaatcttcgaccatctggaa
aagcagcagcgcggcgccggcaacgagatccagctgaccgacgccatggccaagctgatc
ggcagccagcccttccacggcctgcgcttcgagggcacccgctatgactgcggcgacaag
gtcggcttcatcgaggcgacgctggcccacgcgctgaaccggccggacatggccgacaag
gtgcgcgagatgctgcgcaaatattgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system