KEGG   Azospirillum sp. B510: AZL_d03480Help
Entry
AZL_d03480        CDS       T01169                                 

Definition
protein-glutamate methylesterase, two-component response regulator, chemotaxis
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
azl  Azospirillum sp. B510
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:azl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZL_d03480
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AZL_d03480
Enzymes [BR:azl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AZL_d03480
Two-component system [BR:azl02022]
 CheA family
  CheA-CheYBV
   AZL_d03480
Bacterial motility proteins [BR:azl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AZL_d03480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510d:complement(394533..395684)
Genome map
AA seq 383 aa AA seqDB search
MTAGAGSGDGVPTVLVVDDSALMRRRIADLLIEAGFRVETAATGEEALARLPAVDPDVVT
LDVTMPGMDGLTCLARIMVEHPKPVVMVSALTGAGAEETLEALRLGAVEAVRKPAAGSIG
RIGEELVETVRAAASSRPRRVHGLRERLRLARARIAGEDFAAPARPAPSSLAPPSPAAAA
ASRESEGVVLVGVSTGGPGTLEDILPLLPADLRWPVVVAQHMPAAFTATLARRLDELCAL
RVVEVERAVALEPGMVCIARGGADVELARRGGRLQAIRVPASPERPWHPNADRLVTSALR
LLPPDRLVGVLLTGMGNDGAAAMAELHARGGRTIAESEDSAVVFGMPQELIRRGGAGVVL
PSDRIAGQLTRWLPPAARRFGVE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgacggccggggcgggatcgggggatggcgtgccgacggtgctggtggtggacgattcc
gcgctgatgcgccggcgcatcgccgatctgctgatcgaggccggattccgggtggagacc
gccgcgacgggggaggaggccctggcgcgcctgccggccgtcgatccggatgtcgtgacg
ctggatgtcaccatgcccggcatggatggcctgacctgcctcgcccgcatcatggtggaa
catcccaagccggtcgtcatggtctccgccctcaccggggcgggggcggaggagacgctg
gaggcgctgcggctgggggcggtcgaggcggtgcgcaagccggccgccggctccatcggc
cgtatcggcgaggagctggtggagacggtgcgggccgccgcgtcctcccgcccgcgccgg
gtgcatggcctgcgcgaacggctgcggctggcccgcgcccgcatcgccggcgaggatttc
gccgccccggcgcggccggcgccgtcttccctggcgccgccatccccggcggcagcggcg
gcgagccgggagagcgagggggtggtgctggtcggcgtgtccaccggcggccccggcacg
ctggaggacatcctgccgcttctgccggccgatcttcgctggccggtggtggtggcgcag
catatgccggccgccttcaccgcgacgctggcgcgccggctggacgagctgtgcgcgctg
cgggtggtggaggtggagcgggcggtggcgctggagccgggcatggtctgcatcgcccgc
ggcggcgccgatgtggagctggcccggcgtggcggccgcttgcaggcgatccgcgttccg
gcctcgcccgagcggccctggcatcccaacgccgaccggctggtgaccagcgccctgcgg
ctgctgccgcccgaccggctggtcggggtgctgctgaccggcatgggcaatgacggcgcg
gcggcgatggccgagcttcacgcccgcggtggccgcaccatcgccgagtcggaggacagc
gccgtcgtcttcggcatgccgcaggagctgatccggcgcggcggggccggtgtcgtgctg
ccgtcggaccggatcgccggccagctgacccgctggctgccgcccgccgcgcggcgtttc
ggtgtggagtag

DBGET integrated database retrieval system