KEGG   Azospirillum sp. B510: AZL_d05040Help
Entry
AZL_d05040        CDS       T01169                                 

Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
azl  Azospirillum sp. B510
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:azl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510d:complement(609772..612135)
Genome map
AA seq 787 aa AA seqDB search
MSTTTRPSKIVVNAYGQSTDSVAPNFKLLVDGREVGHATASDPSSTAYSFTADLAANTAH
KIQVVYDNDTETSAYRDLYVQSIEVNGHTLKPTDAIYERYDDAAPAPTQPGQEAMWWDGA
LTFGTPASYFAATPSTGPAAAPAPSPAGGTAQNVITVNAAGNAAAGEGAHFTVLVDGQRI
GEGTASGTDAKDYKFTADLAQGTAHSVQVTYDNDAIVDGADRNLYVNSISVDGKTVAATD
ASVSVHRNDNGADIGATSDLYWDATLTARLDASHFTASAGGGNTGTNTGKGGGTAAPAGG
SGTGGDTGALSVKVGNVTVADPGMVQSSGSINGFLHTNGNQIVDESGNNVRLTGVNWFGG
EGYNYVPSGLWADSYQHHIDSMKSLGFNVIRLTWADDLFDSSAVTNGIDYAKNPDLKGLT
RLEVYDKVIDYAGKTGMKVILDHHRNDGGAGTNESGLWYTDKNPESTVIDHWQTLAKRYA
GNEAVVGADLHNEPSVSATWGDGNQATDWAAAAQRIGNAIQSVNKDWLMLVEGTEWSSTL
AGVKDHPIQFDVPNKLVYSPHAYGQSVGQFSWLSDPNYPNNLPAQYDSMWGYIYKNNIAP
ILVGEFGGQMHSAAEQTWASTLIKYMNGDWNLDGKSDLAPGQQGMNWTYWAWTPESGDVG
GLLQDDFKTIDPTKMNILKAGLAAKSGSSGSVPGSDEAVFTVQLAKAVTTATTIDYATED
GTAKAGSDYTATHGSLTFQPGETTKTVSVHITGDNNANEGTENFLLHLTHGNSNLGTATG
TITDHAA
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgaccacccggccgagcaagatcgtcgtcaacgcctacggccagtccacggac
agcgtcgcgccgaatttcaagctgctggtggatggtcgggaggtcggtcacgccacggcg
tccgacccctcgtcgacggcatacagcttcaccgccgaccttgcggcgaacacggcgcac
aagattcaggtcgtctacgacaatgatacggagaccagcgcctatcgcgacctttacgtc
cagtcgatcgaggtcaacggccacacgctgaagccgaccgacgccatctatgaacgttat
gacgatgccgccccggcgccgacccagcccggccaggaagccatgtggtgggacggcgcc
ctgaccttcggcacccccgccagctatttcgccgccaccccgtccaccggccctgccgcc
gccccggcgccctcccctgccggcggcaccgcgcagaacgtcatcaccgtgaacgccgcc
ggcaatgcggcggccggcgaaggcgcgcatttcaccgtgctggtcgatggccagcggatc
ggcgagggcacggccagcggcaccgacgccaaggattacaagttcaccgccgacctggcg
caggggaccgcccattcggtgcaggtgacctacgacaatgacgccatcgtcgatggcgcc
gaccgcaacctgtatgtcaacagcatcagcgtcgacggcaagaccgtggcggcgaccgac
gcctccgtttcggtccaccgcaacgacaacggcgccgacattggcgccaccagcgacctt
tattgggacgccacgctgaccgccaggctggatgccagccatttcaccgcttcggccggc
ggcggcaacacgggcaccaacaccgggaagggaggcggaacggcggccccggccggcggt
tcgggcactggcggcgacaccggcgcgctgtcggtcaaggtcggcaacgtcaccgtggcc
gatccggggatggtacagagcagcggctcgatcaacggcttcctgcacaccaacggcaac
cagatcgtcgacgagagcggcaacaatgtccggctgaccggggtgaactggttcggcggc
gagggctacaattatgtgccgtccgggctgtgggccgacagctaccagcatcacatcgac
agcatgaagagcctgggcttcaacgtcatccgcctgacctgggccgacgatctcttcgac
agcagcgcggtgaccaacggcatcgattacgccaagaacccggatctgaagggcctgacc
cggctggaggtctatgacaaggtcatcgactatgccggcaagaccggcatgaaggtgatc
ctggaccatcaccgcaacgacggcggcgccggcaccaacgaaagcgggctgtggtacacc
gacaagaatccggaatcgacggtgatcgaccattggcagacgctggccaagcgctatgcc
ggcaacgaggcggtggtcggcgccgacctgcacaacgagccgagcgtgtcggcgacctgg
ggcgacggcaaccaggccaccgactgggcggcggcggcccagcgcatcggcaacgccatc
cagtcggtcaacaaggactggctgatgctggtcgagggcaccgagtggagcagcacgctg
gcgggggtgaaggaccatccgatccagttcgacgtgccgaacaagctggtctattcgccg
cacgcctatggccagagcgtcggtcagttcagctggctgtcggacccgaactatccgaac
aacctgccggcccagtatgacagcatgtggggctacatctataagaacaacatcgccccg
atcctggtcggcgagttcggcggccagatgcacagcgcggccgagcagacctgggccagc
acgctgatcaaatacatgaacggcgactggaacctggacggcaagagcgacctcgccccc
ggccagcagggcatgaactggacctattgggcgtggacgccggaatcgggcgatgtcggc
gggctgttgcaggatgatttcaagaccatcgatccgaccaagatgaacatcctcaaggcg
ggtctggcggccaaatccggcagctccggttcggttccgggcagcgacgaggcggtcttc
accgtgcagctggccaaggcggtgaccaccgccaccaccatcgactatgcgaccgaggac
ggcacggcgaaggccggcagcgactataccgccacccatggcagtctgaccttccagccg
ggcgagaccaccaagacggtcagcgtccacatcaccggcgacaacaacgccaatgaggga
acggagaatttcctgctgcacctgacccacggcaacagcaacctgggcaccgccacgggc
accatcaccgaccacgcggcgtaa

DBGET integrated database retrieval system