KEGG   Azospirillum sp. B510: AZL_e00490Help
Entry
AZL_e00490        CDS       T01169                                 

Gene name
cheR
Definition
(GenBank) chemotaxis protein methyltransferase
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
azl  Azospirillum sp. B510
Pathway
azl02020  Two-component system
azl02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:azl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZL_e00490 (cheR)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AZL_e00490 (cheR)
Enzymes [BR:azl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     AZL_e00490 (cheR)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AZL_e00490 (cheR)
Two-component system [BR:azl02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   AZL_e00490 (cheR)
Bacterial motility proteins [BR:azl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AZL_e00490 (cheR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheR CheB_methylest PAS_10 HWE_HK PAS_4 CheR_N CENP-F_leu_zip PAS IncA HisKA_2 DUF4795 AAA_13 AAA_23 HMMR_N TPR_MLP1_2 Methyltransf_12 CCDC144C Spc7 Golgin_A5 DUF1664 Methyltransf_31 PAS_7 HATPase_c_2 APG17 COG5 IFT57 HAUS-augmin3 Sec8_exocyst APG6 Rootletin HOOK SesA FapA DUF5082 Prominin GAS DUF745 Atg14 DegS COG2 Jnk-SapK_ap_N Sec20 Mod_r
Motif
Other DBs
NCBI-ProteinID: BAI76394
RhizoBase: AZLe00490
UniProt: D3P6W5
Position
pAB510e:complement(75562..78705)
Genome map
AA seq 1047 aa AA seqDB search
MSDKASFPIVGIGASAGGVEALEGLFGAVPADSGMAFVVVTHLSPEHESLLADIIGRCTP
TPAHQARDGDLVEPNRIYTLQPGTLLTIDSGRLHVRPDSASRRERNPIDLFLSSLASDCG
ERAVGIILSGGGSDGTLGVKAIKERGGFTIAQGHDGIPRHDGMPNSAIATGGVDLVAPVE
TMAATLVDFARTATSLGDLTSEKDVQEDARLEAARRSITTILRNQIGHDFQGYKHNTFLR
RVQRRMQALRLTDIDSYVEHLREDRTEAAALFRDLLIGVTTFFRDGETFRALEELVIPHL
FAGKSVGDAVRVWVPGCATGEEVYSIAMLLSEYAGTLHSVPKIQVFATDIDEHALEVART
GRYPANLVRDVRADRLKRHFTEDGTSYLVRKEVRDLCIFSSHSVVRDPPFSRIDLISCRN
LLIYLGMGLQDQVIPMFHYALRPSGYLFLGVAETIGQHQTLFVPIDKKHRLFRRQDAVSV
TIPFAMAEHGGRTPRGSAETPRSIQSNAANLRGHVEARVLERFAPAHVVVNQNSEVVYYS
ANTGKYLQAPPGAPNRQLLAMARKGLRLDLRGALHEAMQTHKPVTRKHLAVEVDDRVQML
DLTIEPFDREGEPFFLVLFSDVGEPSPAEEIYGKERHWGQDPVAVEQLERELRDTKERLQ
STIEEYETSLEELKSANEELISVNEELQSTNEELETAKEETQSVNEELHAVNIELNSKVE
ELDQSNSDLQNLFNSTQIGIIFLDRSLLIRSFTPAITQIFNLIATDRGRPLTDIVSHLDQ
VDLDRDLRHALTDPATVEKAVRSRDGTRHYMMRILPYRKARNDLEGLLLTFVDVTSLKEA
EEQQRQLIGELDHRVKNMLAVVTALAQQTLKAIAEAPECTAFLGRLQAVASTYDLLTRDG
WGNVLLSDVVLNEVKPYATSEGRFAVDGPAVQLRPKAALALGMVIHELVTNALKYGALSV
AEGRVVVTWEFGQSDADAVLLVHWREMDGPPVSPPTHHGFGSKLITQQIRYELRGDVMVD
YDPTGLQATFTVPVAQTRSDDESPAPP
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaaggcatccttcccaatcgtcgggatcggcgcgtccgctggcggggtggag
gccttggaggggctgttcggcgccgttcctgccgacagcggcatggccttcgtggtcgtg
acgcatctgtcaccggaacacgaaagcctgctggccgacatcatcggccgatgcacgccc
acgccggcgcatcaggcccgcgacggggatttggtcgagccaaaccgcatctacaccctg
cagccaggaaccctgctgaccatcgacagcggccggctgcatgtccggccggacagcgcc
tcccgccgcgagcgcaacccgatcgacctcttcctcagttcgctcgccagcgactgcggt
gaaagagcggtgggcatcatcctgtcgggcggcggcagcgacggcaccctgggcgtcaag
gcgatcaaggaacggggcggcttcaccatcgcccaggggcatgacggaattccccgccat
gacggcatgccgaacagcgccatcgccaccggcggcgtcgaccttgtcgcgccggtcgaa
acgatggcggcgacgctggtggacttcgcgcgaaccgccacgtcgctgggcgatctgacg
agtgagaaggatgttcaagaggatgcgcggctggaagcggcacgcagaagcatcaccacc
attctgcgcaatcagatcgggcacgatttccagggctacaagcacaacactttcctgcgc
cgtgtccaacgcaggatgcaggccctgcggctgacggacatcgacagctatgtcgaacac
ctgcgtgaggaccgtaccgaagccgcggcactgtttcgcgatctgctgatcggtgtcacc
accttcttccgcgacggcgagaccttccgggcgctggaggaactcgtcatcccgcatctg
ttcgccgggaaaagcgtcggcgatgcggtgcgcgtctgggtgccgggctgcgccaccggc
gaggaggtgtactccatcgccatgctgctgtccgaatatgcgggaaccctccacagcgtg
ccgaagatccaggtcttcgccaccgacatcgacgagcatgccctggaagtggcacgcacc
gggcgctatcccgccaatctggtgcgggatgtgcgggcggaccggctcaaacgccatttc
actgaggacggcaccagctatctcgttcgcaaggaggtgcgcgacctgtgcatcttctcg
tcgcacagcgtcgtccgtgacccgccattttcacgcatcgacctgatttcgtgccgcaat
ctgctcatttacctggggatgggacttcaggatcaggtgatcccaatgttccactatgca
ttgcgccccagcggctatcttttcctcggcgtggccgagaccatcgggcaacatcagacg
ctgttcgtgcccatagacaaaaaacatcgcctgttccgccggcaggatgcggtttccgtg
accattcccttcgccatggcggagcatggcggccgcacgcctcgcggatcggccgagacc
ccccgctcgatccagtccaacgccgccaatctgcgtgggcatgtggaggcgcgcgtgctg
gagcgtttcgctccggcccatgtcgtcgtcaatcaaaacagtgaggtggtctattattcc
gccaacaccggcaaataccttcaggcgccgcccggcgccccgaaccgccagcttctggcg
atggcccgcaagggacttcggctcgatcttcgcggcgccctgcacgaggcgatgcagacc
cacaagccggtaacccgcaagcacctggcggtggaagtggacgatcgtgtccaaatgctc
gatctgacgatcgagccgttcgaccgcgaaggggaacccttcttcctggtcctgttttcc
gatgtcggagagccaagtcctgcggaggaaatctacggcaaggagcgtcactggggccag
gatcctgttgcggtggagcagctggaacgcgaacttcgcgataccaaggagcgtctccag
agcacgatcgaagagtatgaaacctcattggaggaactgaaatccgccaacgaggaactc
atctctgtcaacgaggaactgcaatcgaccaatgaggaattggaaaccgccaaagaggaa
acgcaatccgtcaatgaggagcttcacgctgtcaatatcgaactcaacagcaaggtcgag
gagctggaccagtccaacagcgatctccagaatctgttcaacagcacccagatcgggatc
atcttcctggaccgatccctgctgatccggagtttcacgccggcgatcacccagattttc
aatctgatcgcgaccgaccgtggtcgtccgctgaccgatatcgtcagccatctcgaccag
gtcgatctggatcgggatctgagacatgcgctaaccgacccggcgaccgtggaaaaggcg
gttcggtcaagggacgggaccagacactacatgatgcgcatcctgccttaccggaaagcc
cgcaacgatctggaaggcctgttgttgacctttgtggacgtgacgtcgctcaaggaggcc
gaggagcagcagcgccagctcatcggtgaactcgaccaccgcgtcaagaacatgctggcc
gtcgtcaccgccctggcccagcagacgctgaaggcgattgccgaggcaccggaatgcacg
gcgtttctcgggcgcctgcaggcggtcgccagcacctacgatctgctgacccgtgacggt
tggggaaacgttctcctcagcgacgtcgtgctcaatgaagtgaagccttatgccaccagc
gaaggacgctttgccgttgacggacctgccgttcaactccggcccaaggccgcgttggcg
ctcggcatggtgatccacgagttggtgaccaacgcgctgaaatacggcgcactgtccgtg
gcggaagggcgcgtcgtcgtgacctgggaattcgggcaaagtgatgccgatgcggtgctg
cttgtccattggcgcgagatggacggtccccccgtgtcgcctcccacccatcatggcttc
ggctccaagctgatcacccagcaaatccgctatgaactgcgcggcgatgtcatggtggat
tacgatccgaccggtctccaggcgacgttcaccgtaccggtcgcccagacgaggagcgac
gacgaaagccccgcccccccttga

DBGET integrated database retrieval system