KEGG   Azospirillum sp. B510: AZL_e00580Help
Entry
AZL_e00580        CDS       T01169                                 

Definition
(GenBank) two-component hybrid sensor and regulator modulated chemotaxis protein methyltransferase
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
azl  Azospirillum sp. B510
Pathway
azl02020  Two-component system
azl02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:azl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZL_e00580
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AZL_e00580
Enzymes [BR:azl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     AZL_e00580
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AZL_e00580
Two-component system [BR:azl02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   AZL_e00580
Bacterial motility proteins [BR:azl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AZL_e00580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest CheR HATPase_c PAS_10 Response_reg GAF_2 PAS_4 HisKA CheR_N GAF IncA GAF_3 HMMR_N Golgin_A5 CENP-F_leu_zip PAS DUF745 Spc7 HAUS-augmin3 TMF_TATA_bd COG5 ATG16 CCDC158 Jnk-SapK_ap_N Mnd1 Fez1 Med30 AIP3 zf-C4H2 Dict-STAT-coil FapA STAT_alpha DUF1664 APG6 HATPase_c_2 HOOK Exonuc_VII_L DUF3450 LXG APG17 Seryl_tRNA_N ADIP HemX Sec8_exocyst Mod_r
Motif
Other DBs
NCBI-ProteinID: BAI76403
RhizoBase: AZLe00580
UniProt: D3P6X4
Position
pAB510e:86582..91216
Genome map
AA seq 1544 aa AA seqDB search
MMSADEGTDRHCQDIPRMDQDEQQRIRPGPLAIVGIGASAGGLKAITALLRAIPADSGLT
FVVIQHRIPNNERLLADLLKNVTVLSVHTAHDGIPLEADHIYIAPAGRLPTMEAGQLRIR
ESQQSVDATLPIDIFFRTLATDQQEKAICVVLSGTGADGTNGLRSIKECGGLVVVQDPTT
ADFDDMPGSAIATGMADYILPPERMPGAIVDFVHQPYIGPATAQKTDAPDGALDGILDLL
SAHTKRDHKAYKPRSLTRRIERRMGIHHIADMTEYRAFLGTHPAEIELLSRDILISVTRF
FRDGPAFDILAGEYIVPLVRNQPAGKPIRVWVPACATGEEAYSIAILLMEACTRCGVSPG
FRVFATDVDNRALTVARTGLYPETITVDVSVERLARFFTKAEDGYKVAKPLRDVVSFSQH
DLLSDPPFSKLDLISCRNMLIYIEPDVQKAIFALFHFALLDNGGLFLGTAENLDTLSDLF
APLSKKWRLYRKIGTTRSSAMAVPLTGGRSAVPVPALPTPLRGTSPADIIRQALLLEYAP
AAVLIDGLHRIQYLFGPTGDFLDLPTGEPPWDLTAMARGELRLQLRRAVAQALAVHGRVQ
ISGIRHKRHGVVVPVTVLVIPVRFPRTGSDLLLVTFTADHAVPSTPVAETAPLPMEIDGV
EQLENELRMTREELNDTIEELSATSEALRVANEEILSIGEESQSTTEELETSKEELQSLN
EELSTLNSQLHEKVDELEATTNDLGNLLSSTDIATVFLSSDLRIKRFTPSATRLFALLPQ
DAGRLITDIARHFSDPCLLPDIRSVLSSLMPSEREVSTDDDATFLRRIQPYRTQQGRGEG
VVITFSDVTPLKRTSLAMALQARQYKLIADLGRKDLIGAEGSETLTEAARLIAEGLGADG
VAILGPSEDPSGRRTGDADDLVLLGSAGLSVPQEPAVQIPSDMSTLVGRVFRSRQPSIVE
DFATDQRVRSSMALSGSNFVSGLSVPFGAAARGPSILAVLSRKAGRFNDADLEFVQAIAS
VLGLVIERAGVLRTARAERDFAQAIVDTVREPLLVLDEMLRVVGASAAFHQSFATTPDGV
LGIQLAETAGGLLADPELRRALERIVPDGTVIDALELTIGQGVGDQGAEGRRTLLLNARR
LNQAGGLILLAMEDVTEQVRVREALAAAKAAAELASASKTRFLAAASHDLRQPVQALLMF
HHLVAMQPQGEAAAKLLVSMGNALGAMTAMLDDILDVSRLDAGIIHVTLRSCPVQTVIDS
LCAELSPLAEAAELTLHSVRTSLSVRSDPKLLERILRNFIANAIKYTDQGRILVGCRRAG
PNLRIQVWDTGRGIPPNQLASIFEEFHQVDNPERDRRQGLGLGLSIVDRLAALLHHPIRV
KSAPGRGSVFEILVPLASPDDSLPKDEEMAVSDGGNGERVVVIDDDPTVLDGVAAFLHEL
GYDVVAASDGDTAVERLGNGVPDLVIADFRLKGTETGSEAIRRLERHFAARLPGILLTGD
TSPARIREASASGFLLLHKPLSPEPLLTAIRHALTDRSVEPGTA
NT seq 4635 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcggcggatgaaggcacggatcgtcattgtcaggacattccccgtatggatcag
gatgaacagcagcgcatacggcccggccctttggcgatcgtcggtatcggtgcctcggct
ggcggcctcaaagccatcacggccctgctcagagcgataccggctgacagcggcttgacc
tttgtggtgattcagcaccggattccgaacaatgaacgattgcttgccgacctgttgaaa
aatgtgacggtgctgtcggtccatacggctcatgacgggattccgctggaggccgatcac
atctatatcgctccggcgggtcggttgccgaccatggaggctggccaactgcgcatccga
gaatcgcagcagtctgtcgacgcgaccctgcccatcgacatcttcttccgcacactggcg
accgaccagcaggagaaggcgatctgcgtcgtgctgtccggtaccggcgccgacggcacc
aatggactgcgttcgatcaaggaatgcggtggacttgtggtcgtacaggatccgacgacc
gccgacttcgacgacatgccgggcagcgccatcgccaccggcatggccgactatatcctg
ccgccggagcgcatgcctggcgccatcgtcgatttcgttcaccaaccctatatcgggccg
gcaacggctcagaagactgatgcgccggacggcgcactggacggcatcctcgatctgctg
agtgcacacaccaagcgcgatcacaaggcttacaagccgcggtcgctgacccgccgcatc
gagcggcggatggggattcaccatatcgccgatatgacggaataccgggcctttctgggc
acccacccggccgaaatcgaactgctgtcccgcgacatcctgatcagcgtgacgcgcttt
ttccgcgatggtccggcgttcgacatcctggccggagaatacatcgtcccgctggtgcgg
aaccagccggcgggcaagccgatccgcgtctgggtcccagcctgcgccacgggggaagag
gcttactccatcgcaatcctgttgatggaggcctgcacacggtgcggcgtatcccccggc
ttccgggtcttcgcaaccgacgtggacaatcgggcgctgaccgtcgcccgcaccggtctg
tatcccgaaaccatcacggtcgacgtgtcggtcgaacggctcgcccgcttcttcaccaag
gccgaggacggctacaaggtcgccaagccattgcgcgatgtggtttccttctcccagcac
gatctgctcagcgatccgcctttttccaagctcgacctgatcagttgccgcaacatgctg
atctatatcgagccggacgtgcagaaggccatcttcgccctgttccatttcgccttgttg
gataatggcggcctgttcctcgggacagcggagaaccttgacacgctctccgacctgttc
gcacctctttcaaaaaaatggcgcctctaccggaagatcggtacgacgcgcagcagtgcg
atggcggtcccgctgacgggcggacggtctgcggtcccggtaccggcactgccaacccct
ttgcgcggcaccagcccggcggacatcatccgacaggccctgctgcttgaatacgcgccg
gcggcagttctgatcgacgggctgcatcgcatccagtatctcttcggtccgaccggcgat
ttcctcgacctgccgacgggagaaccgccctgggatctgacggcgatggcacgcggggaa
ttgcgcctgcaactccgccgcgccgtcgcacaggcgctcgccgtgcatggccgggttcaa
atctccggaattcggcacaagcgtcacggtgttgtggtgccggtgaccgttctggtcatc
ccggtgcgtttcccacggaccggcagcgacttgcttctggtgacattcacggcggaccac
gctgtaccaagcacgccggtcgccgagaccgcgccgctgccgatggaaattgacggagtc
gaacagctcgaaaacgaactgcgcatgacccgtgaggagttgaacgacaccatcgaagaa
ctcagcgccaccagcgaggcgctgcgggtcgccaacgaggagatcctgtcgatcggggag
gagtcccagtcgaccacggaggaactggagacatccaaggaagagctgcaatccctcaac
gaggaactcagcacgctgaactcccagctgcatgaaaaggtcgacgagctggaggcgacc
accaacgatctgggcaatctgctgagcagcaccgacatcgccacggtcttcctgtcgtca
gacctgcggatcaagcgtttcacgccgtcggcgacccggctgttcgctctgctgccgcag
gacgccggccgcctgatcaccgacatcgcccgacatttctccgatccttgcctgctcccc
gacatccggtcggtgctgtcatccctgatgccgtcggaacgcgaagtgtcgacggacgac
gatgcgaccttccttcgccgcatccagccctaccggacgcagcaaggccggggggagggg
gtcgtgatcaccttcagcgacgtgacgccgctgaagcgcaccagcctggccatggctctg
caggcccgccagtacaagctgatcgccgatctcgggcgcaaggacctcatcggagcggag
ggctcggagacactgacggaagcggcccgtctgattgccgaagggctgggtgcggacggc
gtcgccatcctcggtcccagcgaggatccatcgggccggcgcaccggggacgctgacgat
ctggtcctgctcggcagtgccggcctctccgttccacaggagcctgccgtccagatcccc
agcgacatgtcgacactggtcggacgggtgttccggtcccggcagccgtcgatcgtcgag
gatttcgccaccgatcaacgtgtccgctcctccatggcgctgtcgggcagcaacttcgtc
agcggtctgtcggttcccttcggcgccgccgcacgcggaccatccattctcgcggttctg
agccgcaaggccggacggttcaacgatgccgacctggaattcgtccaggccatcgccagc
gtgctggggctggtcatcgaacgggcgggggtgctgcgcacggcgcgggctgagcgcgat
ttcgcccaggccatcgtcgacacggtccgcgaaccgctgctggtgctggacgagatgctg
cgggtggtcggcgcgagtgcggcctttcaccaatccttcgccaccacgccggacggcgtg
ctcggcattcaactggccgagacggccggcggtctgctggccgatcccgaactgcgccgg
gcactggaacggatcgtacccgatggcacggtcatcgatgcgctggaactgaccatcggt
cagggtgtcggcgaccaaggcgccgagggacgccgcaccctgctgctgaacgcccgccgg
ctcaatcaggcgggagggctgatcctgttggcgatggaagacgtcacagagcaggtgcgc
gtgcgagaagccctcgccgccgccaaggctgccgccgaactggcaagcgccagcaaaacc
cgatttcttgccgctgccagccacgacctgcgtcaaccggtccaggccctgctgatgttc
catcatctggtggcgatgcaaccgcagggcgaggcggcggcaaagctgctggtcagcatg
ggcaacgcactgggcgccatgaccgccatgctcgacgacatcctggatgtgtcgcgcctc
gacgccggcatcatccatgtgacgctccggtcatgtccggtccagacggtgatcgattcg
ctgtgcgccgagttatcgccgttggccgaggctgccgaactgacattgcacagcgttcgg
accagcctgtcggtgcggagcgatcccaagctgctggagcgcatcctgcggaacttcatt
gccaacgcgatcaaatacaccgaccagggtcgtatcctggtgggttgccgccgtgccggg
ccgaacctgcgcatccaggtttgggacaccggacgcggcattccgccgaaccagttggcg
tcgatcttcgaggagttccatcaggtcgacaatccggagcgtgaccggcggcaggggctg
gggctgggactctccatcgtggatcgcctcgccgcgctgctccatcacccgatacgggtc
aaatcggcgccagggcggggatcggtgttcgaaatcctggttccgttggccagtccggac
gattcccttccgaaggacgaggagatggccgtatccgacggcggcaacggcgagcgggtg
gtggtgatcgacgacgacccgaccgttctcgacggggtcgccgccttcctccatgaattg
ggctacgatgtggtggctgcatccgatggcgacacggcggtggagcggttggggaacggg
gtgccggatttggtcatcgccgatttccggctgaagggcacggaaaccggatcggaggca
atccgccggctggagcggcatttcgccgcccggctgcccggaatccttctgaccggagac
acttcgcccgcgcgcatccgggaggcgagcgccagcggcttcctgttgctgcacaagcca
ctgagcccggagcctctgctgactgccatacgacacgccctgacggaccggtccgtggag
ccgggaaccgcctga

DBGET integrated database retrieval system