KEGG   Azospirillum sp. B510: AZL_e01240Help
Entry
AZL_e01240        CDS       T01169                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
azl  Azospirillum sp. B510
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:azl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510e:164016..165173
Genome map
AA seq 385 aa AA seqDB search
MPPLSARPAAKAAPKSAAGSLAGFCPWAGEDGVRVYLRPTGLMPIAAWAKGAAVPLAGGR
FAFSTAELIVRDGGSRIDRAFAPLAEIMAWGWERSRAVAEALDRQLGALTRARAPFAGLA
LDRPLIMGIVNVTPDSFSDGGDFLDPAAAIAHGEAMLAAGADILDIGGESTRPGADPVPP
AEEERRVLPVIRHFAERGAAVSVDTRHARVMASAAMAGARIVNDIAGLADPQALPVVARA
GIPVVVMHMQGEPGTMQASPVYRDAALDVFDWLEERIARCAAAGLAPERIAVDPGIGFGK
TMEHNLEILRHTALYHALGCTVLIGLSRKTFIGRLSRGEPPKERLAGSLAAGLETLNQGA
QILRVHDVAETVQARAVWEGLHPRP
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgctctccgcaaggcccgccgccaaagccgcacccaaatcggccgccgggtcg
ctggccggcttctgcccctgggcgggcgaggacggggtgcgggtctatctgcggcccacc
gggctgatgcccatcgccgcctgggccaagggggcggcggtgccgctggccggtgggcgc
ttcgccttctccaccgccgagctgatcgtccgcgacggcggcagccgcatcgaccgcgcc
ttcgctcccctggcggagatcatggcctggggctgggagcgctcccgcgcggtggcggag
gcgctggaccgccagctcggcgccctgacccgcgcccgcgctcccttcgccgggctggcg
ctcgaccggccgctgatcatgggcatcgtcaatgtgacgccggacagcttctccgacggc
ggcgatttcctcgaccccgccgccgccatcgcccatggcgaggcgatgctggccgccggg
gccgacatcctcgacatcggcggcgaatccacccgtcccggcgccgacccggtcccgccg
gccgaggaggagcggcgcgtgctgccggtcatccgccatttcgcggagaggggggccgcc
gtttcggtcgatacccgccatgcccgggtcatggcgtcggcggcgatggccggcgcccgc
atcgtcaacgacatcgccgggctggccgatccgcaggccctgccggtggtggcgcgcgcc
ggcatcccggtggtggtcatgcacatgcagggcgaacccggcaccatgcaggccagcccg
gtctaccgtgacgccgccctcgacgtcttcgactggctggaggaacggatcgcccgctgc
gccgccgccggcttggccccggaacgcatcgccgtcgatcccggcatcggcttcggcaag
acgatggagcataatctggagatcctgcgccacaccgcgctgtatcacgcgctgggctgc
accgtcctgatcggcctgtcgcgcaagaccttcatcggccgcctgtcgcgcggggagccg
ccgaaggagcggctggccggctcgctcgccgccgggctggagacgctgaaccagggcgcc
cagatcctgcgcgtccacgatgtcgccgagacggtccaggcccgcgccgtctgggaaggg
ctgcatccccgcccgtaa

DBGET integrated database retrieval system