KEGG   Azospirillum sp. B510: AZL_e01400Help
Entry
AZL_e01400        CDS       T01169                                 

Gene name
melA
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
azl  Azospirillum sp. B510
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AZL_e01400 (melA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    AZL_e01400 (melA)
   00600 Sphingolipid metabolism
    AZL_e01400 (melA)
Enzymes [BR:azl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AZL_e01400 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510e:complement(183655..184938)
Genome map
AA seq 427 aa AA seqDB search
MPNTTKIVFIGAGSAAFGLSLFQDLFSTTELAGSTLTLVDTNVEALDRMAALADVLNRHG
NAGLTIEKTTDRKAALQGAGFVLCAIAIDRNRLWKLDFEVPRKHGIRHTLGENGGPGGLF
FTLRTLPLIVDIARDVEAICPDALFINLSNPESRIVLGLSRCTNVRTLGLCHGIFLARWF
ICQILGMAEKEVDVWGAGLNHFQWLTAIREKATGRDLYPLLREREATHDPSFTPLARRLF
HAFGLWVTPSDDHTGEFLPYGWEAGEHGFDFKHDEEGRVILRDLMDGVIDGSRPIPDDWT
RPSWGERAVAVIAGQLHNQKRFIESGIVINRGVIPGLPDELAVEVPLVADAAGVHPVSLG
RLPDGILKLLSVQANVQQLSVEAALRGSKELALQALLIDPVVNSSAAAAAILDELWEANR
PYIRACL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacaccaccaagatcgtcttcatcggcgccggcagcgccgccttcggcctcagc
ctgttccaggatctgttctccaccacggagctggccggcagcaccctgacgctggtcgac
accaatgtggaagcgctcgaccgcatggcggcgctggcggatgtgctgaaccgccacggg
aatgccggcctcaccatcgagaagaccaccgaccgcaaggccgccctccagggcgccggt
ttcgtgctgtgcgccatcgccatcgaccgcaaccggctgtggaagctggatttcgaggtg
ccgaggaagcatggcatccgccacacgctgggcgagaatggcggccccggcgggctgttc
ttcacgctccgcaccctgccgctgatcgtcgacatcgcccgcgacgtcgaagcgatctgc
cccgacgccctgttcatcaacctgtcgaatccggaaagccgcatcgtgctgggcctgtcg
cgctgcaccaatgtgcggacgctcgggctctgccacggcatcttcctggcgcgctggttc
atctgccagatcctgggcatggcggagaaggaggtcgatgtctggggcgccgggctgaac
catttccaatggctgaccgcgatccgcgagaaggcgacgggccgcgacctctatcccctg
cttcgcgagagggaggcgacgcacgatccgtccttcactccgctggcgcgccgcctgttc
catgccttcggcctgtgggtcacccccagcgacgaccacaccggcgaattcctgccctat
ggctgggaggccggggaacacggcttcgacttcaaacatgacgaggaggggcgcgtcatc
ttgcgcgacctgatggatggcgtcatcgacggcagcaggccgatcccagatgattggacc
agaccgtcctggggcgagcgggcggtggcggtgatcgcgggccagctgcacaaccagaag
cgcttcatcgaaagcggcatcgtcatcaaccgcggcgtcatccccggcctgcccgacgag
ctggcggtggaggtgccgctggtggccgacgccgccggtgtccatccggtctcgctcgga
cggctgcccgacggcatcctgaagctgctgtcggtccaggccaacgtgcagcaactgtcg
gtggaggcggcgctgcgcggatcgaaggagctggccttgcaggcgctgctgatcgatccc
gtcgtgaattccagcgccgccgccgccgccatcctggatgagctgtgggaggcgaaccgg
ccctacatccgggcctgcctgtga

DBGET integrated database retrieval system