KEGG   Azospirillum sp. B510: AZL_e02150Help
Entry
AZL_e02150        CDS       T01169                                 

Gene name
etf
Definition
electron-transferring-flavoprotein dehydrogenase (EC:1.5.5.1)
Orthology
K00311  
electron-transferring-flavoprotein dehydrogenase [EC:1.5.5.1]
Organism
azl  Azospirillum sp. B510
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510e:270298..271971
Genome map
AA seq 557 aa AA seqDB search
MEREPREVMEYDVLIVGAGPSGLSAAIRLRQRAVESGQELSVCVIEKGSEVGAHLLSGAV
FEPHALEELIPDWKEKGAPLTTQAREDHFLFLTETKAYKSPVTPPQMNNHGNYIISLGNL
ARWLATQAEELGVEIYPGFAAAEVLYDDTGAVKGVATGDMGIGKDGEKTGNYTPGMELHA
KQTIFAEGCRGSLTKTLFERFDLRRDCQPQTYGIGIKELWEVDPSKSKPGLIVHTIGWPM
DPKTYGGSWLYHMEGNLVSVGFVVGLDYWNPHMSPFEEFQRYKTHPAIRPTFEGGRRLAY
GARALSEGGFQSIPKLTFPGGLIVGDAAGFLNVPKIKGNHTAMKSGMVAAEAVFDHLTGG
EGTGDGNGAANGTEVIAYPERLKQSWVWPELHAVRNIRPGFQKGLWAGIANAAYETALKG
KSPWTLKHHADHTTLVKASEAPKIAYPKPDGKVSFDRLSSVYLSNTNHEEDQPAHLTLKD
KSVPIGINLALYDAPEQRYCPAGVYEIVRNDDGGDPRLQINAQNCVHCKTCDIKDPTQNI
NWVVPEGGGGPNYPGGM
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcgaaccgcgcgaggttatggaatatgatgttctgatcgtcggcgccggcccg
tcgggcctgagcgcggcgatccgtctgcggcagcgcgcggtcgagagcgggcaggagctc
agcgtctgcgtgatcgagaaggggtcggaggtgggcgcccacctgctgtccggcgccgtc
ttcgaaccgcatgcgctggaggagctgatcccggactggaaggagaagggcgcgcccctg
accacccaggcgcgcgaggatcatttcctgttcctgacggagaccaaggcctacaagtcg
cccgtcaccccgccgcagatgaacaaccacggcaactacatcatcagcctgggcaacctc
gcccgctggctggcgacccaggccgaggagctcggggtggagatctaccccggcttcgcc
gccgccgaggtgctgtatgatgacacaggcgcggtgaagggcgtcgccaccggcgacatg
ggcatcggcaaggacggcgagaagaccggcaactacacgccgggcatggaactgcacgcc
aagcagaccatcttcgccgagggctgccgcggctcgctgaccaagaccctgttcgagcgg
ttcgacctgcgccgcgactgccagccgcaaacctacggcatcggcatcaaggagctgtgg
gaggtcgatccgtcgaagtccaagccgggcctgatcgtccacaccatcggctggccgatg
gatcccaagacctatggcgggtcgtggctgtatcacatggaggggaatctggtgtcggtc
ggcttcgtcgtcggcctcgattactggaacccgcacatgagcccgttcgaggagttccag
cgctacaagacccacccggcgatccgcccgaccttcgagggcggccgccgtctggcctat
ggcgcccgcgccctgtcggagggcggcttccagtcgattccgaagctgaccttccccggc
ggcctgatcgtcggcgatgcagccggcttcctgaacgtgcccaagatcaagggcaaccac
accgcgatgaagtccggcatggtcgccgccgaggcggtgttcgaccatctgaccggcggt
gaaggcaccggcgacggcaatggggcggccaatgggacagaggtgatcgcctatccggag
cgcctcaagcagtcctgggtctggccggagctgcatgcggtgcgcaacatccgccccggc
ttccagaagggcctgtgggccggcatcgccaatgccgcctacgaaacggcgctgaagggc
aagtcgccctggacgctgaagcaccacgccgaccacaccaccctggtgaaggccagcgag
gcgccgaagatcgcctaccccaagccggacggcaaagtcagcttcgaccgtctgtcctcg
gtctacctctccaacaccaaccatgaggaggaccagccggcccacctgacgctgaaggac
aagtcggtgccgatcggcatcaatctggcgctctacgacgcgccggaacagcgctactgc
ccggccggcgtctacgagatcgtccgcaacgacgacggtggcgatccgcgcctgcagatc
aacgcgcagaactgcgtccactgcaagacctgcgacatcaaggaccccacccagaacatc
aactgggtcgtgccggaaggcggcggggggccgaactatcccggcggcatgtga

DBGET integrated database retrieval system