KEGG   Azospirillum sp. B510: AZL_e02500Help
Entry
AZL_e02500        CDS       T01169                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
azl  Azospirillum sp. B510
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AZL_e02500 (ispE)
Enzymes [BR:azl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     AZL_e02500 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510e:317738..318826
Genome map
AA seq 362 aa AA seqDB search
MRHRGRRRASASGLELMTGNSIIEAAPAKLNLYLHVTGRRADGYHELDSLVAFAELGDGI
ALTPGATRVALRGADLPPAGPRLAIAGPFGPALMGEAPSGNLVMRAAHALATRLGREADV
MIALTKVLPVASGIGGGSADAAACLRALARLWGLPADDPALFAVAAGLGADVPVCVAGRS
CYFGGIGDVLDEAPELPETHVVLVNPNLPVSTPAVFKAMAAARAESGAAFSTPARFAREP
ADAADLAALLGERRNDLTAPALTVAPVIADVVAALERSAGCLLPRLSGSGATCFGLYATA
AAAEAAARVIAAAEPGWWVKPTRLRPTPPGSPALPRGIVADRVGDIPPPAAPFPDTGGWG
IG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgcgacacaggggacgtcgtcgcgcgtccgccagcggattggagctcatgaccggcaat
tccatcatcgaggccgcaccggccaagctgaacctctatctgcatgtcaccggccgccgc
gccgacggctatcacgagttggacagcctcgtcgcctttgccgaactgggcgacggcatc
gccctgacgccgggagcgacgcgggtggctctgcgcggagcggatttgccgcccgccggc
ccgcgcctggccatcgccggccccttcggcccggccctgatgggcgaggcgccgtccggc
aacctcgtgatgcgcgccgcccacgcactggccacccggctgggccgcgaggccgatgtg
atgatcgccctgaccaaggtgctgccggtcgcatcaggaatcggcggcggatcggccgat
gccgccgcctgcctgcgggcgctggcccggctgtggggactgccggccgacgatccggcg
ctgttcgcggtggccgccgggctgggcgccgacgtgccggtctgcgtcgccggacgaagc
tgctatttcggcggcatcggcgacgtgctggacgaggcgccggaattgccggaaacccat
gtggttctggtcaaccccaacctgccggtgtcgaccccggcggtgttcaaggcgatggcc
gccgcccgtgccgaaagcggcgccgccttctccacccccgcgcgcttcgcccgcgagccc
gccgacgccgccgacctcgccgctctgctgggtgagcggcgcaacgacctgaccgcgccg
gccctgacggtggcgccggtgatcgccgatgtcgtggcggcgctggagcgcagcgcgggt
tgcctgctgccccgcctatccggcagcggcgccacctgcttcggcctctacgccacggcg
gcggcggcggaagccgcggccagggtcatcgcggcggcggagcccggctggtgggtcaag
ccgacccgcctgcgccccaccccgcccggttcccccgccctgccgcgcggcatcgtcgcc
gatcgggtgggcgacatcccaccaccggccgcgccctttccggacaccggcggatggggg
atcggctga

DBGET integrated database retrieval system