KEGG   Azospirillum sp. B510: AZL_e03590Help
Entry
AZL_e03590        CDS       T01169                                 

Definition
(GenBank) simple sugar transport system ATP-binding protein
  KO
K02056  simple sugar transport system ATP-binding protein [EC:3.6.3.17]
Organism
azl  Azospirillum sp. B510
Module
azl_M00221  Putative simple sugar transport system
Brite
Enzymes [BR:azl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     AZL_e03590
Transporters [BR:azl02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter [MD:M00221]
    AZL_e03590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 RsgA_GTPase AAA_30 AAA_22 AAA_23 AAA_16 MMR_HSR1 Zeta_toxin AAA_24
Motif
Other DBs
NCBI-ProteinID: BAI76704
RhizoBase: AZLe03590
UniProt: D3P7S5
Position
pAB510e:complement(453214..454758)
Genome map
AA seq 514 aa AA seqDB search
MTASTAPPSAPLLAIRGLSKAFLGVQALDGVDFTLRHGEIHALLGENGAGKSTLIKTLTG
VYQRDGGTVALEGREIAPRGVEEAQRLHIGTVYQEVNLLPNLSVAENLFLGRQPMRFGLV
DRGAMRRRARAVLQPYGLSVDVTAPLGRFSVATQQIIAIARAVDMSAKVLILDEPTASLD
AQEVAVLFKVMRTLRSHGIGIVFVTHFLDQVYEVCDRITVLRNGRLVGERRTAELPRLDL
VAMMLGRELEAAAHRIDLGPEEIDTRPPLARFKAFGKARSVEPFDLDIRPGEVVALAGLL
GSGRTETVRLVFGMDRADSGEAVVDGRPARLKGPRDAVRLGFGFCPEDRKKEGIVGELSV
RENIILALQARQGWLKPIPRRRQEEIADRFIRLLDIRTPDAERPIQLLSGGNQQKALLAR
WLATEPRLLILDEPTRGIDVGAHAEIIRLIERLCADGMALLVVSSELEEIVAYSRRVVVL
RDRRHVAELRGGEVSVERIVAAIASETPNREVRQ
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgtccaccgctcccccttccgctccgttgctggcgatccgcgggctgtcgaag
gcgtttctcggcgtgcaggcgctcgacggcgtcgatttcaccctgcgccacggcgagatc
catgcgctgctgggtgagaacggcgccggcaaatcgacgctgatcaagacgctgaccggc
gtctatcagcgcgacggcggcaccgtggcgctggaggggcgggagatcgcgccgcgcggg
gtcgaggaggcgcagcgcctgcacatcggcaccgtctatcaggaggtgaacctgctgccc
aacctgtcggtggcggaaaacctgttcctgggccgccagccgatgcgtttcgggctggtc
gatcgcggcgccatgcggcggcgggcgcgggcggttctgcaaccctatggcctgtcggtc
gacgtgacggccccgctcggccgtttttcggtcgccacccagcagatcatcgccatcgcc
cgcgcggtcgacatgtcggccaaggtgctgatcctggatgagccgaccgccagcctggac
gcgcaggaggtggcggtgctgttcaaggtgatgcggaccctgcgctcgcatgggatcggc
atcgtcttcgtcacccatttcctcgatcaggtctatgaggtctgcgaccgcatcaccgtg
ctgcgcaacggccggctggtcggcgagcggcgcaccgccgagctgccgcgcctggatctg
gtcgccatgatgctggggcgggagctggaggcggcggcccaccgcatcgacctcggtccg
gaggagatcgatacccgtccgccgctggcccgattcaaggccttcggcaaggcgcgcagc
gtcgagcccttcgacctcgacatccgccccggcgaggtggtggcgctggccgggctgctg
gggtcgggacggacggagacggtgcggctggtcttcggcatggaccgcgccgacagcggc
gaggcggtggtggacggccgaccggcgcggctgaaggggccgcgcgacgccgtgcggctc
ggcttcggcttctgtccggaggaccgcaagaaggagggcatcgtcggcgagctgtcggtg
cgcgagaacatcatcctggcgctccaggcgcggcagggctggctgaagccgatcccacgc
cgccgccaggaggagatcgccgaccgcttcatccgcctgctcgacatccgcacgccggac
gccgaacggccgatccagcttttgtcgggcggcaaccagcagaaggcgttgctggcgcgc
tggctggcgaccgagccgcgcctgctgatcctcgacgagccgacgcgcggcatcgatgtc
ggcgcccatgccgagatcatccgcctgatcgagcggctgtgcgccgacggcatggcgctg
ctggtcgtctcgtcggagctggaggagatcgtcgcctacagccgccgcgtcgtcgtgctg
cgcgaccgccgccatgtggcggagttgaggggaggggaggtcagcgtggagcgcatcgtc
gccgccatcgcgtcggagacaccgaacagagaggtgcggcaatga

DBGET integrated database retrieval system