KEGG   Azospirillum sp. B510: AZL_e03610Help
Entry
AZL_e03610        CDS       T01169                                 

Definition
(GenBank) outer membrane protein porin
Organism
azl  Azospirillum sp. B510
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Porin_4
Motif
Other DBs
NCBI-ProteinID: BAI76706
RhizoBase: AZLe03610
UniProt: D3P7S7
Position
pAB510e:complement(456232..457389)
Genome map
AA seq 385 aa AA seqDB search
MVRSALLLGAATLSLASVVAAGPASAQSKFDITIGGDAYFEGGYVNQDRDAGQRNTEFRN
RLRLLVTPKAKADNGLEYGARLRLLAENGTGNARTTSYDRAFMFVNGGFGVLHLGVENGP
SDDSGIIAPSDWGTGGVDGSFPSWLGNSAANAPVTIGNIRALISGNSATRATYWTPEFAG
FKFGASYQPSSDSSGTDINRSKLALASANRTGAYRDVYEVGGTYTNTLGGVAVNGSLFYL
GGQAKNSTTTPAVSFDNLSSTHAGLTLAYAGFKIGGSYAWSGDSGYAKASTPGIVSREKQ
DVWTAGAQYTFGATTLGVGYLNAKDAGDLTIRGRSKFELITVGAKYVVAPGFSVAPEYNH
FKLSSDVAANSDKGDIFLLRTDLAF
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggtgagatccgctctgctgcttggcgcagccaccctttcgctcgcctccgtcgtggcc
gccggtccggcgtcggcccagtcgaagttcgatatcacgattggcggtgacgcctatttc
gaaggcggctacgtcaaccaggaccgcgatgccggccagcgcaacaccgagttccgcaac
cgtctacgcctgctggtgacgccgaaggccaaggccgacaacggtctggaatatggcgcc
cgcctgcgcctgctggccgagaacggcaccggcaacgcccgcaccaccagctatgaccgc
gccttcatgttcgtcaatggcggcttcggcgtcctgcatctgggtgtggagaacggtccg
tcggacgacagcggcatcatcgccccgtccgactggggcaccggcggcgtcgacggctcc
ttcccgtcctggctcggcaacagcgccgccaacgcgccggtcaccatcggcaacatccgc
gccctgatctccggcaacagcgccacccgcgccacctactggaccccggaattcgccggc
ttcaagttcggcgcctcctaccagccgtcgtcggacagcagcggcaccgacatcaaccgc
tccaagctggcgctggcgtccgccaaccgcaccggcgcctatcgcgacgtctatgaagtc
ggcggcacctacaccaacacgctcggcggcgtggcggtcaacggcagcctgttctatctc
ggcggacaggccaagaactccaccaccaccccggcggtgagcttcgacaacctgtcctcg
acccatgccggtctgaccctggcctatgccggcttcaagatcggcggcagctatgcctgg
tcgggtgacagcggctatgccaaggccagcacccccggcatcgtcagccgcgagaagcag
gatgtgtggacggccggcgcgcagtacaccttcggcgccaccacgctcggcgtcggttac
ctcaacgccaaggatgccggcgatctgacgatccgcggccgcagcaagttcgagctgatc
accgtcggcgccaaatatgtcgtcgcccccggcttcagcgtcgcgccggaatacaaccac
ttcaagctcagctccgacgtcgccgccaacagcgacaagggcgacatcttcctgctccgc
acggatctggccttctaa

DBGET integrated database retrieval system