KEGG   Azospirillum sp. B510: AZL_e03670Help
Entry
AZL_e03670        CDS       T01169                                 

Gene name
gguA
Definition
(GenBank) multiple sugar transport system ATP-binding protein
  KO
K10548  
putative multiple sugar transport system ATP-binding protein [EC:3.6.3.17]
Organism
azl  Azospirillum sp. B510
Pathway
ABC transporters
Module
Multiple sugar transport system
Brite
KEGG Orthology (KO) [BR:azl00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    AZL_e03670 (gguA)
Enzymes [BR:azl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     AZL_e03670 (gguA)
Transporters [BR:azl02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Multiple sugar transporter [MD:M00216] [OT]
    AZL_e03670 (gguA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
pAB510e:463592..465187
Genome map
AA seq 531 aa AA seqDB search
MNSILEMRGITKTFPGVKALDNVNLSVREGEIHALIGENGAGKSTLMKVLSGVYPHGSYE
GEIRFAGQPVAFRSIADSEKLGIIIIHQELALVPLLSITENLFLGNEQAKRGRIDWVAAT
ARARELLRMVGLTDSPETLITDIGVGKQQLVEIAKALSKEVKLLILDEPTASLNESDSDA
LLELLLRFKEQGISSILISHKLNEIAKVADRVTILRDGTTVETLDCQHAPISQDRIIKGM
VGRDLADRYPRRASNPGDILFEVKGWNADHPIHAGRRVVKDIDLHVRRGEVVGIAGLMGA
GRTEFAMSLFGRSYGRNIRGRAFLGGREIDVSTIRRAMNSGLAYATEDRKHYGLVLDNDI
RHNVTLAKLDGVAKRGVIHHEREIEVANEFRRRLRIRCSDVFQQTVNLSGGNQQKVVLSK
WLFADPQVLILDEPTRGIDVGAKYEIYTIVNQLVAEGRGVILISSELPELLGVADRIYVM
NEGALVAEMPAAEASQEKIMHAIMSSASQSTAARAAVAAAALNTGARESLQ
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtattcttgagatgcgcggcatcaccaagacgttcccgggcgtcaaggcgctc
gacaacgtcaatctctcggtccgcgagggggagattcacgcgctgatcggcgagaacggc
gccgggaaatcgacgctgatgaaggtgttgagcggcgtctacccgcacggcagctacgag
ggtgaaatccgcttcgccggccagcccgtcgcctttcgcagcatcgccgacagcgagaag
ctgggcatcatcatcatccatcaggaactggcgctggtcccgctgctgtcgatcaccgag
aacctgttcctcggcaacgagcaggccaaacggggccggatcgactgggtcgccgccacc
gcccgcgcccgcgagctgctgcgcatggtcggcctgaccgattcgcccgagaccctgatc
accgacatcggcgtcggcaaacagcaactggtggagatcgccaaggccctgtccaaggag
gtcaagctgctgatcctggacgagccgaccgccagcctgaacgagagcgacagcgacgcg
ctgctggagctgctgctgcgcttcaaggagcagggcatctcctccatcctgatctcgcac
aagctgaacgagatcgccaaggtcgccgaccgcgtcaccatcctgcgcgacggcaccacg
gtcgagacgctggattgccagcacgcgccgatcagccaggaccgcatcatcaagggcatg
gtcggccgcgacctcgccgaccgctatccgcgccgcgccagcaacccgggcgacatcctg
ttcgaggtcaagggctggaacgccgaccacccgatccatgccggccgccgcgtcgtcaag
gacatcgacctgcatgtgcgccggggcgaggtggtgggcatcgccggactgatgggcgcc
ggccgcaccgaattcgccatgagcctgttcggccgctcctatggccgcaacatccgcggc
cgggccttcctcggcgggcgcgagatcgacgtgtcgaccatccgccgggcgatgaacagc
ggtctcgcctacgccaccgaggaccgcaagcattacggcctcgtgctcgacaacgacatc
cgccacaacgtgacgctggccaagctggacggggtcgccaagcgcggcgtcatccaccac
gagcgcgagatcgaggtggccaatgagttccgccgccgcctgcgcatccgctgttccgac
gtgttccagcagacggtcaacctgtccggcggcaaccagcagaaggtcgtgctgagcaaa
tggctgttcgccgacccgcaggtgctgatcctggacgagccgacccgcggcatcgacgtc
ggcgccaaatatgaaatctacaccatcgtcaaccagctggtggccgaaggccgaggcgtc
atcctgatctcctcggaactgccggagctgctgggtgtcgccgaccgcatctatgtgatg
aacgaaggcgccctggtcgccgagatgccggcggccgaggccagccaggaaaagatcatg
cacgccatcatgtcgtccgcctcgcaatccacggcggcccgcgccgccgtcgccgccgcc
gctttgaacactggtgcccgggagtccctgcaatga

DBGET integrated database retrieval system