KEGG   Azospirillum sp. B510: AZL_e03680Help
Entry
AZL_e03680        CDS       T01169                                 

Gene name
gguB
Definition
(GenBank) multiple sugar transport system permease protein
  KO
K10547  putative multiple sugar transport system permease protein
Organism
azl  Azospirillum sp. B510
Pathway
azl02010  ABC transporters
Module
azl_M00216  Multiple sugar transport system
Brite
KEGG Orthology (KO) [BR:azl00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    AZL_e03680 (gguB)
Transporters [BR:azl02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Multiple sugar transporter [MD:M00216] [OT]
    AZL_e03680 (gguB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: BAI76713
RhizoBase: AZLe03680
UniProt: D3P7T4
Position
pAB510e:465184..466383
Genome map
AA seq 399 aa AA seqDB search
MSAELNLPAAPPRQASMAKFLKSHMRDYGMLISLLAIVAFFQYMTNGTLLQPLNLTNLVL
QNSYIVIMALGMLLVIVAGHIDLSVGSIVGFIGALAAILMVQFHWHFIPTAIVSLIAGAA
IGAAQGYWVAYFRIPSFIVTLAGMLVFRGLSLALLAGQSVGPFPVEFQRLSSGFIPDFFG
TEGFHTTTLLLCLATPAIMIGFSIAARLRRHRFAIEQEPLVLFLLKSAGLFAVVAYVGWL
LSTYKGLPNVLIIMALLIGLYAFVTRDTTIGRRIYALGGNEKAAKLSGIDTRRLSFYTFV
NMGVLAALAGLIFAARLNTATPKAGVSFELDVIAACFIGGASASGGVGRVTGAVIGAFIM
GVMNNGMSILGIGIDWQQVIKGLVLLAAVCFDVYNKGKA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgaactgaacctgccggccgcgccgccgcgccaggcctcgatggccaagttc
ctgaagagccacatgcgcgactacggcatgctgatctcgctgctggcgatcgtggcgttc
ttccagtacatgaccaacggcacgctgctgcaaccgctgaacctgaccaacctcgtcctg
cagaacagctacatcgtcatcatggcgctgggcatgctgctggtgatcgtcgccgggcac
atcgacctgtcggtcggctcgatcgtcggcttcatcggcgcgctggccgccatcctgatg
gtgcagttccactggcacttcatcccgaccgccatcgtcagcctgatcgccggtgcggcg
atcggcgccgcccagggctattgggtcgcctatttccgcatcccgtccttcatcgtgacg
ctggccggcatgctggtcttccgcggcctcagcctcgccctgctcgccggccagtcggtc
ggtcccttcccggtggagttccagcgcctcagctccggcttcatcccggatttcttcggc
accgaaggcttccacaccaccacgctgctgctgtgcctggcgacgccggcgatcatgatc
ggattcagcatcgccgcccgcctgcgccgccaccgcttcgccatcgaacaggaaccgctg
gtcctgttcctgctgaagagcgccggcctgttcgccgtggtcgcctatgtcggctggctg
ctgtcgacctacaagggcctgcccaacgtcctgatcatcatggcgctgctgatcggcctc
tacgccttcgtcacccgcgacaccaccatcggccggcgcatctacgcgctgggcggcaac
gagaaggcggccaagctgtcgggcatcgacacccgccgcctgtccttctacaccttcgtc
aacatgggcgtgctggcggcgctcgccggcctgatcttcgccgcccgcctcaacacggcc
acgccgaaggccggcgtgtcgttcgagctggacgtgatcgccgcctgcttcatcggcggc
gcctcggcgtccggcggtgtcggccgggtgaccggtgccgtgatcggcgccttcatcatg
ggtgtgatgaacaacggcatgtcgatcctcggcatcggcatcgactggcagcaggtgatc
aagggtctggtgctgctcgccgccgtctgcttcgacgtctacaacaagggcaaggcctga

DBGET integrated database retrieval system