KEGG   Azospirillum sp. B510: AZL_e03750Help
Entry
AZL_e03750        CDS       T01169                                 

Definition
(GenBank) molybdenum storage protein beta subunit
  KO
K00947  molybdenum storage protein
Organism
azl  Azospirillum sp. B510
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: BAI76720
RhizoBase: AZLe03750
UniProt: D3P7U1
Position
pAB510e:480204..481016
Genome map
AA seq 270 aa AA seqDB search
MANSTAELEALLMQRPLTDAELQATAEAAANFRILPDATVIKIGGQSVIDRGRSAVYPLV
DEIAAARKAHRLLIGTGAGTRARHLYSIAAGLGLPAGVLSQLGSSVADQNAAMLGQLLAK
HGVSAVDGAGLSAVPLYLAEVHAVVFSGMPPYTLWMRPPASGVIPPYRTDAGCFLVAEQF
GCKQMIYVKDENGLYTANPKTSKDATFIPRISVDEMKAKGLQDSILEFPVLDLLKAARHV
REVQIINGLVPGNLTRALAGEHVGTIITAS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggccaattccacggcggaacttgaggctctgctgatgcagcgcccgctgaccgacgcc
gagcttcaggcgacggcggaggcggcggcgaatttccgcatcctccccgatgccacggtg
atcaagatcggcggacagagcgtcatcgaccgcggccggtcggccgtctatccgctggtg
gacgagatcgcggcggcgcgcaaggcgcaccggctgctgatcggcaccggcgccggaacc
cgcgcccgccacctctactccatcgccgccggcctcggcctgccggcgggcgtgctgtcg
cagctcggctcgtcggtcgccgaccagaacgccgccatgctggggcaactgctcgccaaa
catggcgtctccgccgtggacggcgccggcctgtcggcggtgccgctctatctggcggag
gtgcatgcggtggtgttcagcggcatgccgccctacacgctttggatgcgtccgccggcc
agcggggtcatcccgccctaccgcaccgatgccggctgtttcctggtcgccgaacagttc
ggctgcaagcagatgatctatgtgaaggacgagaacgggctctacaccgccaatcccaag
acgtcgaaggacgccaccttcatcccgaggatctcggtcgatgagatgaaggcgaagggg
ttgcaggattcgatcctggaattcccggtcctcgacctgctgaaggccgcgcgccatgtc
cgcgaggttcagatcatcaatggtctggtccccggcaacctgacccgtgcgctggccggc
gagcatgtcggcaccatcatcaccgcgagctga

DBGET integrated database retrieval system