KEGG   Azospirillum sp. B510: AZL_e03810Help
Entry
AZL_e03810        CDS       T01169                                 

Definition
(GenBank) two-component response regulator
Organism
azl  Azospirillum sp. B510
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat Response_reg Sigma54_activ_2 HTH_8 AAA_5 Mg_chelatase AAA_16 AAA HTH_28 HTH_23 HTH_29 APS_kinase
Motif
Other DBs
NCBI-ProteinID: BAI76726
RhizoBase: AZLe03810
UniProt: D3P7U7
Position
pAB510e:complement(489458..490882)
Genome map
AA seq 474 aa AA seqDB search
MSPSKKRRVLLIEDTVPLARLYIEFLRAEAHDIVHCTRGGEALDAAAAAPPDAVILDLKL
PDMDGLEVLQALHARDPGISVVVVTAHGSIDLAVEAMRLGAFDFIVKPFNADRLNLTLRN
ALERRILARIVEGYRKDLDRGRFHGFIGSSPEMQAVYRTIESVAVSRANVFITGESGTGK
EVAAQAIHRASPRRGAAFVALNCAAIPKDLLESEIFGHVKGAFTGAAGDRPGAALLADGG
TLFLDEICEMPIDLQSKLLRFVQTGTVNPVGSGREQRVDVRFVAATNRDPLAEVQAGRFR
EDLYYRLHVIPLALPPLRERGDDVVEIARSFLVEYAREEGKALSSFAPEVEARLRAHDWP
GNVRQLQNIVRNVVVLHDGQQVLPDMLPPMAGPDAGAGHGLRAACGMPRSAAAEEDDAVQ
PLWRVEKELIQKALRLTGDDVPRAALLLEISPSTIYRKLQQWRVAENAAGETAA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
gtgtccccatcgaaaaagcgccgcgtcctgctgatcgaggatacggtcccgcttgcccgg
ctctacatcgagttcctgcgcgcggaggctcatgacattgtgcattgcacacgcgggggc
gaggcgctggacgcggcggcggcggcaccgcccgacgcggtgatcctcgacctgaagctg
ccggacatggacgggctggaggtgctccaggcgctgcatgcccgcgaccccggcatctcc
gtggtggtggtcaccgcccatgggtcgatcgatctggcggtcgaggccatgcggctcggc
gccttcgacttcatcgtgaagcccttcaacgccgaccggctgaacctgaccctgcgcaac
gcgctggagcggcggatcctggcccggatcgttgagggataccgtaaggatcttgatcgc
gggcgcttccatggcttcatcggcagttcgccggagatgcaggcggtctaccgcaccatc
gagagcgtggcggtcagccgcgccaacgtcttcatcaccggcgagagcggcaccggcaag
gaggtggcggcccaggcgatccaccgcgccagcccgcggcgcggcgccgccttcgtcgcg
ctcaactgcgccgccattcccaaggatctgctggaatcggagatcttcggccatgtgaag
ggcgccttcaccggggcggcgggcgaccggccgggggcggcgctgctggccgacggtggc
acgctgttcctcgacgagatctgcgagatgccgatcgatctccagagcaagcttctgcgc
ttcgtccagaccggcacggtcaatcccgtcggcagcgggcgggagcagcgggtggacgtg
cgtttcgtcgccgccaccaaccgcgatccgctggccgaggtgcaggccggccgcttccgc
gaggatctctattaccgcctgcacgtcatcccgctcgccctgccgccgttgcgcgagcgt
ggcgacgacgtggtcgagatcgcccgctccttcctggtcgagtatgcgcgcgaggagggg
aaggcgctgtcgtccttcgcgccggaggtggaggcgcggctgcgcgcccatgactggccc
ggcaatgtgcggcaattgcagaatatcgtccgcaacgtggtggtgctgcatgacgggcag
caggtcttgcccgacatgttgccgccgatggccgggccggatgccggcgccggccatggc
ctccgcgccgcctgcgggatgccgcggagtgccgcggcggaggaagatgacgcggtccag
ccgctgtggcgggtcgagaaggagttgatccagaaggcgctgcggctgaccggcgatgac
gtgccgcgcgccgccctgctgctggagatcagcccctccaccatctaccgcaagctccag
caatggcgtgtcgccgaaaacgcggccggggagaccgccgcgtga

DBGET integrated database retrieval system