KEGG   Azospirillum sp. B510: AZL_e03820Help
Entry
AZL_e03820        CDS       T01169                                 

Gene name
pdhR
Definition
(GenBank) transcriptional regulator
  KO
K05799  GntR family transcriptional regulator, transcriptional repressor for pyruvate dehydrogenase complex
Organism
azl  Azospirillum sp. B510
Brite
Transcription factors [BR:azl03000]
 Prokaryotic Type
  Helix-turn-helix
   GntR family
    AZL_e03820 (pdhR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FCD GntR MarR_2 Rrf2 HTH_11 HTH_24 HTH_20 HTH_Crp_2 MarR PaaX HTH_29 Fe_dep_repress HTH_27 HTH_28 TrmB
Motif
Other DBs
NCBI-ProteinID: BAI76727
RhizoBase: AZLe03820
UniProt: D3P7U8
Position
pAB510e:complement(491015..491785)
Genome map
AA seq 256 aa AA seqDB search
MQGTIKPAKLADAIAEHLERLILEGALRPGEKLLAERELAVKLDVSRPSLRDAIAKLEER
GLLVSGRGGTHVATFLSQITDPLMTLMRNKPDASFDYLEFRRSIEVAAAGLAAQRATDVD
RDGIRAIVARMQAAHGKDDSSEEADSDADLHLAIYEAAHNVVMLHIMRTLSDLLRNDVFY
NRADLYSRPGVRELLLQQHLAIANAVLAGDAAAASAAAEAHVEFTLQTLREIREHNARVQ
VSLRRIGRTDLIDSGA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggacgatcaaaccggccaagctggccgacgccattgccgagcatttggaaagg
ctgatcctggaaggcgcgctgcgtccgggcgagaagctgctggccgagcgcgaactggcg
gtgaagctggacgtgtcgcgcccgtccctacgcgacgccatcgccaagctggaggagcgc
ggcctgctggtcagcggccgtggcggcacccatgtggcgaccttcctgtcgcagatcacc
gatccgctgatgacgctgatgcgcaacaagccggacgcgtccttcgactatctggaattc
cgccgctccatcgaggtggcggcggccgggctggcggcgcagcgggcgaccgacgtcgac
cgcgacggcatccgcgccatcgtcgcccgcatgcaggccgcccacggcaaggacgacagc
tcggaggaggcggattccgacgccgacctgcatctggcgatctacgaggcggcgcacaat
gtcgtgatgctgcacatcatgcggacgctgtccgacctgttgcgcaacgacgtgttctac
aaccgtgccgacctctattcccggccgggggtgcgcgagctgctgttgcagcagcatctg
gccatcgccaacgcggtgctggccggcgacgcggcggcggcgagcgccgcggccgaggcc
catgtcgagttcacgttgcagaccctgcgcgagatccgcgagcacaatgcgcgggtccag
gtgtcgctacggcggataggacggaccgacctgatcgacagcggggcgtga

DBGET integrated database retrieval system