KEGG   Azospirillum sp. B510: AZL_e03860Help
Entry
AZL_e03860        CDS       T01169                                 

Definition
(GenBank) 4Fe-4S ferredoxin, iron-sulfur binding
  KO
K18929  L-lactate dehydrogenase complex protein LldF
Organism
azl  Azospirillum sp. B510
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LUD_dom DUF3390 Fer4_8 Fer4 Fer4_10 Fer4_17 Fer4_9 Fer4_7 Fer4_6 Fer4_2 Fer4_4 Fer4_21 Fer4_3 Fer4_16 Fer4_18 Fer4_20 Fer4_13
Motif
Other DBs
NCBI-ProteinID: BAI76731
RhizoBase: AZLe03860
UniProt: D3P7V2
Position
pAB510e:497674..499098
Genome map
AA seq 474 aa AA seqDB search
MDGNAPDFAAASRAALADPELRGNFRRAMDGLMSKRAAQFADTGEWTGVRALAAAVRLRA
LSKLPELLEKLEETCTRNGITVHWAATTDDANAIALDILHKANAKLVVKGKSMVTEEMHL
NAVLEQDGIEVLESDLGEYIVQMDGTMPSHIIMPAIHLNTRQIAHLFKRKLKDAESREDA
AYLTDLARRVLRAKFEAADVGMSGVNAAVAETGTLCLIENEGNGRMCTTVPPVHIAFMGL
EKVVERLEDVPPVISLLPRSATGQPITTYVNMISGPRKDGEKDGPREVHLVILDNGRSGI
YADPELRDTLRCIRCGACMNHCPVYTKVGGHAYEAPYPGPIGKILVPQIEGLAKRGAMPH
ACTMCNACVEICPVKIPIVEIMGRLRVEAVRPGGAVKDGGAKASRTESMVWSGWAAMNAS
PTAYRLATAAMSKLGNAAPSSLPVLKEWTNVRTKPRFAGRTLHDLARAKGIPDV
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggacggtaacgcaccggatttcgccgccgcctcgcgcgcggcgctggccgacccggag
ctgcgcggcaatttccgccgcgccatggacggcttgatgagcaagcgcgccgcccagttc
gccgacaccggcgaatggaccggggtgcgggcgctcgccgcggcggtccggctgcgcgcc
ctgtccaagctgccggaactgctggaaaagctggaggagacctgcacccgcaacggcatc
accgtccattgggccgccacgacggatgacgccaacgccatcgcgctcgacatcctgcac
aaggccaacgccaagctggtggtcaagggcaagtcgatggtgacggaggagatgcacctg
aacgccgtgctggaacaggacggcatcgaagtgctggaaagcgacctcggcgaatatatc
gtgcagatggacggcaccatgccgtcccacatcatcatgccggcgatccacctcaacacc
agacagatcgcccatctgttcaagcgcaagctcaaggacgccgaaagccgggaggatgcc
gcctatctgaccgacctcgcccgccgggtgctgcgcgccaagttcgaggcggcggatgtc
ggcatgtccggcgtcaacgccgcggtggcggagaccggcaccctctgcctgatcgagaat
gagggcaacggccgcatgtgcaccacggtgccgccggtccacatcgccttcatggggctg
gagaaggtggtggagaggctggaggacgtgccgccggtgatcagcctcttgccgcgctcc
gccaccggccagccgatcaccacctacgtcaacatgatctccggcccgcgcaaagacggc
gagaaggacggcccgcgcgaggtgcatctggtcatcctcgacaatggccgctccggcatc
tacgccgacccggagctgcgcgacacgctgcgttgcatccgctgcggcgcctgcatgaac
cattgcccggtctacaccaaggtcggcggccatgcctatgaggcgccctatccggggccc
atcggcaagatcctggtgccgcagatcgaggggctggccaagcgcggcgccatgccccac
gcctgcaccatgtgcaacgcctgcgtcgagatctgcccggtgaagatcccgatcgtcgag
atcatgggccggctgcgggtggaggcggtgcggcccggcggtgccgtgaaggatggcggc
gccaaggccagccggacggaatcgatggtgtggagcggctgggcggcgatgaacgcctct
cccaccgcctaccgcctcgccaccgcggcgatgagcaagctcggcaacgccgcgccctcg
tcgctgcccgtgctgaaggagtggacgaatgtccgcaccaagccgcgcttcgccggccgc
accctgcacgacctcgcccgcgccaaggggattcccgatgtctga

DBGET integrated database retrieval system