KEGG   Azospirillum sp. B510: AZL_e03900Help
Entry
AZL_e03900        CDS       T01169                                 

Definition
(GenBank) hypothetical protein
Organism
azl  Azospirillum sp. B510
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zinc_ribbon_4 zinc_ribbon_5 DUF3426 TF_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: BAI76735
RhizoBase: AZLe03900
UniProt: D3P7V6
Position
pAB510e:complement(503077..503886)
Genome map
AA seq 269 aa AA seqDB search
MIVSCPTCSTRYTLSDDSLGQDGRKVRCARCGHMWWQKPERQESEPVIPDALTELRPSMP
VKPGARARIRHGRGPRAKPARGTVIGFALLGLLVAGSAAGAYFGRDVLVDRWPPAARLYD
LAGMPAEPPGFGLDLRNIHSEQKQEGGKTVLLLDGEVANTTDGERRLPPLRVNSFGPERK
LLQSWVVEPSAETLGPGAAAAFHHSQPDPGPVVEVTITFGGPPPGLEAPAAEKPVEKATE
KGGEKPAAKPAADKHAADKHTAPAKPSGH
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtttcctgcccgacctgttcaacgcgctataccctgtccgacgactcgctcggt
caggatggccggaaggtccgttgcgcccgctgcggccacatgtggtggcagaagcccgag
cggcaggagagcgagccggtcatccccgacgcgctgacggagctgcgcccgtcgatgccg
gtgaagccaggcgccagggccaggatcaggcatggcagggggccgcgtgccaaaccggcg
cgcggcacggtgatcggcttcgccctgctgggtctgctggtcgccgggtccgccgccggc
gcctatttcggccgcgacgtcctcgtcgaccgctggccacccgccgcccggctctatgac
ctcgccggcatgccggccgaaccgccgggattcgggctggacctgcgcaacatccattcc
gaacagaagcaggagggcggaaagaccgtcctgctgctggacggcgaggtcgccaacacc
accgacggcgagcgccggctgccgccgttgcgcgtcaacagcttcggcccggagcgcaag
ctgttgcagagctgggtcgtcgagccgtcggccgagacgctggggccgggggccgcggcg
gcgttccatcacagccagcccgatccggggccggtggtcgaggtgaccatcaccttcggc
ggtccgccgcccggcctggaggcgccggcagcggagaagccagtggagaaggccactgaa
aagggtggggaaaagccggcggcgaaacccgccgccgacaagcatgccgccgacaagcac
accgccccggccaagccgtcaggccactga

DBGET integrated database retrieval system