KEGG   Azospirillum sp. B510: AZL_e03930Help
Entry
AZL_e03930        CDS       T01169                                 

Definition
(GenBank) two-component sensor histidine kinase
Organism
azl  Azospirillum sp. B510
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisKA_7TM HATPase_c PAS_4 HisKA PAS_8 PAS
Motif
Other DBs
NCBI-ProteinID: BAI76738
RhizoBase: AZLe03930
UniProt: D3P7V9
Position
pAB510e:506054..507910
Genome map
AA seq 618 aa AA seqDB search
MTLPSVLLLAAVVATLWIAARSWLLPPFPGRTDFVLMQLSATWWSTSVAVESMVTAPADK
LFWAEMAWMGIVCTPSLWAFFLWSYTRGELPARWRLVLVAVGLANWAMALTNDLHHLFYT
ATRPIDATPGAALVYSHGLLFYATTVYIYAFMVMSIVVTASGIHRATRAYRTHYLGFLVV
MAVPWTANASYIFGNVTLFNQDPTAFSFLLMDGIFYWLITRRRLFELLPVARDALLDAVP
DPVLVLDADGTVVEANPAGLALVRDGTPLGRRLADLPGLSALASWDAALPLALELDCGGD
PRSFEATRVPLTSGGGAREAGAREVGRLLLLRDVTHRRRAEMRLEDSVRRLDLAHQETER
RLLAEQEAKRALKGFLSMAAHEFKTPLAIIDGAAQILLLDAEGKAPAMLPRLEKIRRAVR
RQVNILDTCLADDRLNDPAFTLHRDRVELPALLRAAAAAQCDAAPGRRIDLYLDDCPPWL
TADGPMLELCVHNLLNNALKYSPPAKPVRLAVREEDGADGHWLALSVTDQGIGIPAGERD
RVFDRFFRASNTGTAAGSGVGLNMVRRIALLHGGTVAVDSRLGEGSVFTLRLPLCREEAL
REAGNAGGMIGGGDRFLH
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgacccttccgtcagtcctgcttctggccgcggtcgtcgccaccttgtggatcgcagcg
cgcagctggctgcttcctcccttccccggccgtaccgacttcgtgctgatgcagttgtcg
gccacttggtggtcgacgtccgtcgcggtggagagcatggtcacggcgccggccgacaag
ctgttctgggccgagatggcctggatgggcatcgtctgcacccccagcctgtgggccttc
ttcctctggtcctacacgcggggcgagttgccggcgcgctggcggctggtgctggtggcg
gtcgggctggcgaactgggcgatggcgctgaccaacgacctgcatcacctgttctacacc
gcgacccgcccgatcgatgcgacgccgggcgcggcgctggtctacagccacgggctgctg
ttctacgccaccaccgtctacatctatgccttcatggtgatgagcatcgtcgtcaccgcc
agcggcatccatcgggcgacgcgggcctaccgcacccattacctgggcttcctggtggtg
atggcggtgccgtggaccgccaatgccagctatattttcggcaacgtgaccctgttcaac
caggacccgaccgccttcagctttctgctgatggacggaatcttctattggctgatcacc
cggcggcgcctgttcgaactgctgccggtcgcccgcgacgcgctgctggacgcggtgccc
gacccggtgctggtcctcgatgccgacggcacggtggtggaggcgaacccggccgggctg
gcgctggtgcgcgacggcacgccgctcgggcgccggctggccgatcttcccggactgtcg
gcgctcgcctcctgggacgccgctctgccgctggcgctggagctggactgcggcggcgat
ccgcgcagcttcgaggcgaccagggttccgctgacctcgggcggcggggcgcgggaggcc
ggggcgcgggaggtcggccgcctgctgctgctgcgcgatgtcacccaccgccgccgggcc
gagatgcggctggaggacagcgtgcgccgcctcgacctcgcccaccaggagacggagcgg
cggctgctggccgaacaggaggccaagcgggcgctgaagggcttcctgtcgatggccgcg
cacgagttcaagaccccgctcgccatcatcgacggcgccgcccagatcctgctgctggat
gccgagggcaaggcccccgccatgctgccgcggctggagaagatccgccgcgccgtgcgg
cggcaggtcaatattctggacacctgcctggcggacgaccggctgaacgaccccgccttc
acgctgcatcgcgaccgggtggagctgccggccctgctgcgcgccgccgccgccgcgcag
tgcgacgcggcacccggccggcgcatcgacctttatctcgacgattgtccgccatggctg
accgccgacggcccgatgctggagctgtgcgtccacaatctgctgaacaacgcgctgaaa
tactccccgcccgccaagccggtcaggctggccgtccgcgaggaggatggggcggacggg
cattggctcgccctgtcggtgaccgaccagggcatcggcatcccggcgggcgagcgcgac
cgggtgttcgaccgtttcttccgcgcctccaacaccgggacggcggcgggcagcggcgtc
gggctgaacatggtccgccgcatcgccctgctgcatggcggaacggtggcggtggacagc
cggctgggcgagggcagcgtcttcacgctgcggctcccgctgtgccgcgaggaggcactc
cgcgaggccgggaatgccggcgggatgatcggcgggggagatcgtttcttgcattga

DBGET integrated database retrieval system