KEGG   Azospirillum sp. B510: AZL_e03960Help
Entry
AZL_e03960        CDS       T01169                                 

Definition
(GenBank) hypothetical protein
Organism
azl  Azospirillum sp. B510
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
pAB510e:complement(509788..510063)
Genome map
AA seq 91 aa AA seqDB search
MTGWASWRADIDALVFRPAGHGGWCAVHRLAFRALLDKREPVPEDCLAHAAAHRAAFEAA
AAGKIARRGLGAAASLHLTSRDVARFLQPRV
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgacgggctgggcgtcctggcgcgccgacatcgacgcgctggtcttccgcccggccggc
catggcggctggtgtgccgtccaccggttggccttccgcgccctgctcgacaagcgggaa
ccggtgccggaggactgcctcgcccatgccgccgcccaccgcgccgccttcgaggcggcg
gcggccggcaagatcgcgcggcgcggccttggcgccgcggccagcctgcacctgaccagc
cgcgacgtcgcccgcttcctccagccccgtgtctag

DBGET integrated database retrieval system