KEGG   Azospirillum sp. B510: AZL_e03990Help
Entry
AZL_e03990        CDS       T01169                                 

Definition
(GenBank) methyl-accepting chemotaxis protein
Organism
azl  Azospirillum sp. B510
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal HAMP 4HB_MCP_1 DUF2525
Motif
Other DBs
NCBI-ProteinID: BAI76744
RhizoBase: AZLe03990
UniProt: D3P7W5
Position
pAB510e:513489..515696
Genome map
AA seq 735 aa AA seqDB search
MPNDSLSMTPSTMMPSTMTPNGTHARRGAWYSGLRVKLMIAIAVVLSGTLVAAAVALIGY
ANVRTTIDTIVGEAVPAMTEGMAVAQQAERLVALAPALTSATNAAAREAVSADLAKEKEE
FNARLTRLRATGSAGPQLAAIEEASKGLLANLAQLDQAAAERVGLATDRMGTMPKVMAAE
AEIQKFAAPWMSVLNNDEEQARSTLAEEDATPAAMREAAASLTDVMTKKKPVQTVTADAA
TIRNMLMEAASTDDEQRLAIIETRITLSLANLSNNAQLLPDRLAAVTSKQAELLTGFANG
EKSLITIRQKELAIEGYFTQLLESNHALTNTLAKGIATLVEGQKASIAEAIDATARMLDN
SRLTQIAVAAASILVSILVVWLYVGRVIIRRMLALKTGMGRIAAGDLDAEIALAGQDEIA
EMGTALLVFRDTAREVETTRAAAEAERLRAAGERRQTMLSLADQFESGVKTVVETVSAAA
TQMHQTAAGMVATADDTSRQAGNAAEAAETASVNVDGAASAAHQLSRSISEISRQVTESA
SIAAKAAGEAERTDGTMRALNEAAGRIGAVLDLISDIAGQTNLLALNATIEAARAGEAGK
GFAVVAQEVKQLASQTAKATDQIAGQIGAMQQATGQAVDAIRSIGHTIGRLNDIAASIAA
AVEEQGAATSEIARNVQQAAGGTAQASHNIGEVRTAAGQTGRSAQEVLSVAQEVSSQTGR
LQQQIDRFLSQVRSA
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacgacagcctcagcatgacgcccagcaccatgatgcccagcaccatgacgccc
aatggcacgcacgcccggcgcggcgcctggtattccggcctgcgcgtcaaactgatgatc
gccatcgccgtggtgctgtccggcacgctggtggccgccgccgtcgcgctgatcggttat
gccaatgtgcgcaccacaatcgacaccatcgtcggcgaagcggtgccggcgatgaccgag
ggcatggcggtggcgcagcaggccgaacggctggtggcgctggccccggccctgacctcc
gccaccaacgccgcggcgcgcgaggcggtgtcggcggacctcgccaaggagaaggaggag
ttcaacgcgcggctgacccgcctgcgggccaccggctccgccggaccccagctcgccgcc
atcgaagaggcgtcgaaggggctgctcgccaatctggcccagctcgatcaggcggccgcc
gagcgggtggggctggccaccgaccgcatggggacgatgccgaaggtgatggcggcggag
gccgagatccagaaattcgccgccccttggatgtccgtcctcaacaatgacgaggaacag
gcccgctcgaccctggccgaagaggatgccacccccgccgcgatgcgcgaggcggcggcc
agcctgaccgatgtcatgaccaagaagaagccggtgcaaaccgtcaccgccgacgccgcc
accatccgcaacatgctgatggaggccgcgagcaccgatgacgagcagcggctggccatc
atcgagaccaggatcaccctgtcgctcgccaacctgtcgaacaacgcccagcttctgccg
gaccgtctggccgccgtcacctccaagcaggcggagctgttgaccggcttcgccaacggc
gaaaagtccctgatcaccatccgccagaaggagctggcgatcgagggctatttcacccag
cttctggagagcaaccacgccctgaccaacaccctggccaagggcatcgccaccttggtt
gagggccagaaggccagcatcgccgaggccatcgacgccaccgcccgcatgctggacaac
agccgcctgacccagatcgccgtcgccgccgccagcatcctggtgtcgatcctggtggtc
tggctctatgtcggccgggtcatcatccgccggatgctggcgctcaagaccgggatgggc
cggatcgccgccggcgacctcgacgccgagatcgcgctggccggccaggatgagatcgcc
gagatggggacggccctgctggtcttccgcgacaccgcccgcgaggtggagaccacccgc
gccgccgccgaggccgagcgcctgcgggccgccggcgaacgccggcagaccatgctgtcg
ctggccgaccagttcgagagcggcgtgaagacggtggtggagacggtgtccgccgccgcc
acccagatgcaccagaccgccgccggcatggtggcgaccgccgacgacacctcccgtcag
gccggcaacgccgccgaggcggctgaaaccgcctcggtcaatgtcgacggcgccgcctcg
gccgcgcatcagctgtcgcggtcgatcagcgagatctcccggcaggtgaccgaatcggcc
tccatcgccgccaaggctgccggcgaggcggaacgcaccgacggcaccatgcgcgccctg
aacgaggcggcgggccgcatcggcgccgtgctcgacctgatctccgacatcgccggccag
accaaccttctggcgctgaacgcgaccatcgaggccgcccgcgccggggaggccggcaag
ggcttcgccgtggtggcgcaggaggtcaagcagctggccagccagacggcgaaggcgacc
gaccagatcgccggccagatcggcgccatgcagcaggcgaccggccaagcggtcgacgcc
atccgcagcatcggccacaccatcggccgcctgaacgacatcgccgccagcatcgccgcg
gcggtggaggaacagggtgccgccacctccgagatcgcccgcaacgtccagcaggcggcg
ggcgggaccgcccaggcgtcgcacaacatcggcgaggtgcgcaccgccgccggccagacc
ggccgttcggcgcaggaggtcctgtcggtcgcccaggaggtctcgtcccagaccggccgc
ctgcaacagcagatcgaccgcttcctcagccaggtgcggtcggcctga

DBGET integrated database retrieval system