KEGG   Azospirillum sp. B510: AZL_e04060Help
Entry
AZL_e04060        CDS       T01169                                 

Gene name
lytS
Definition
(GenBank) two-component system, LytT family, sensor histidine kinase
  KO
K02478  two-component system, LytTR family, sensor kinase [EC:2.7.13.3]
Organism
azl  Azospirillum sp. B510
Brite
Enzymes [BR:azl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     AZL_e04060 (lytS)
Protein kinases [BR:azl01001]
 Histidine kinases
  LytTR family [OT]
   AZL_e04060 (lytS)
Two-component system [BR:azl02022]
 LytTR family
  Unclassified
   AZL_e04060 (lytS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5TM-5TMR_LYT His_kinase GAF_3 HATPase_c SpoVT_C
Motif
Other DBs
NCBI-ProteinID: BAI76751
RhizoBase: AZLe04060
UniProt: D3P7X2
Position
pAB510e:complement(523428..525125)
Genome map
AA seq 565 aa AA seqDB search
MLPEPFTLVLSLLQQMCVYLVIAYLMSRTPLFLPLTHVTVRWPHKLACYVIFSIFCIMGT
YFGLHIDDSIANTRAIGAVLGGIFGGPSVGLAVGLTGGLHRYSLGGMSALACAISTMAEG
LIGGLVHRHMISHGRIEPLFNPLRVGAVTFLAELVQMLIILAVARPFEAALHLVEVVAAP
MIVANTLGAALFMRILLERRVLDEKQSSAFSAKALKIAARCDGVLRGGFNSENSTRVARI
IFEETGVGAVAITDREKLLAFIGMGDDHHLPGTPISSPQTHQAIANNQVIYADGNEVAYR
CSISPSCRLGAALVIPLVGEEGGVIGTIKLYEPKTKIFSTINRTLGEGVARLLSNQILAG
RYEQQKALLAQSEIKLLHAQVNPHFLFNALNTISAVIRNDPERARQLVQNLSTFFRKNLK
RPSETATLGDEVEHVNAYLQIELARFTGRLAVEIDVPDGLRSARLPAFSLQPLVENAIKH
GTAQLLEDGRVRIAARREGGDLLLSVEDNAGLYEAKPGGDGLGMTIVDRRIRNRYGDAYG
VSIACDPDAFTRVTLRLPLEEAVPA
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgcttcccgagcccttcaccctggtcctctccctgcttcagcagatgtgcgtctatttg
gtgatcgcctatctgatgagccggacgccgctgttcctgccgctgacccatgtgacggtg
cgctggccgcacaagctggcctgctatgtgatcttctcgatcttctgcatcatggggacc
tatttcggcctgcacatcgacgacagcatcgccaacacccgcgccatcggggcggtgctg
ggcggcattttcggcgggccgtcggtggggctggcggtcgggctgaccgggggactgcac
cgctattcgctgggcggcatgtcggcgctggcctgcgccatctccaccatggcggagggg
ctgatcggcgggctggtccaccgccacatgatcagccacgggcggatcgagccgctgttc
aacccgttgcgcgtcggcgccgtcaccttcctggcggaactggtgcagatgctgatcatc
ctggcggtggcccgccccttcgaggcggcactgcatctggtggaggtggtggcggcgccg
atgatcgtcgccaatacgctgggggcggccctgttcatgcgcatcctgctggaacgccgg
gtgctggacgagaagcagtccagcgccttttccgccaaggcgctgaagatcgccgcgcgc
tgcgacggggtgctgcgcggcggcttcaacagcgagaacagcacccgtgtcgcccgcatc
atcttcgaggagaccggcgtcggcgccgtcgccatcaccgaccgcgagaagctgctggcc
ttcatcggcatgggcgacgaccatcatctgccgggcacgccgatcagctcgccccagacc
catcaggccatcgccaacaatcaggtcatctatgccgacggcaacgaggtggcctatcgc
tgctcgatcagcccgagctgccggctgggggcggcgctggtgatcccgttggtcggggag
gagggcggggtgatcggcaccatcaagctgtatgagccgaagaccaagatcttctccacc
atcaaccgcacgctgggggagggggtggcgcggctgctgtccaaccagatcctggccggg
cgctacgagcagcagaaggcgctgctggcgcagtcggagatcaagctgctgcatgcccag
gtcaacccgcatttcctgttcaatgcgctgaacaccatctccgccgtcatccgcaacgat
ccggaacgggcgcgccagctggtgcagaacctgtccaccttcttccgcaagaacctgaag
cgcccgagcgagacggcgacgctgggcgacgaggtggagcatgtgaacgcctatctccag
atcgagctggcccgcttcaccggccggctggcggtggagatcgacgtgccggacgggttg
cgttccgcccggctgccggccttctcgctccagccgctggtcgagaacgcgatcaagcac
ggcacggcgcaactgctggaggacgggcgggtgcgcatcgccgcccggcgcgagggtggc
gatttgctgctgtcggtggaggataatgccgggctctatgaggccaagccgggcggcgac
gggctgggaatgaccatcgtcgaccgccgcatccgcaaccgctacggtgacgcctatggc
gtctccatcgcctgcgatcccgatgccttcacccgcgtcaccctgcgtctgcctcttgag
gaagcggtgcccgcatga

DBGET integrated database retrieval system