KEGG   Azospirillum sp. B510: AZL_e04080Help
Entry
AZL_e04080        CDS       T01169                                 

Definition
(GenBank) haloacid dehalogenase/epoxide hydrolase
Organism
azl  Azospirillum sp. B510
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: BAI76753
RhizoBase: AZLe04080
UniProt: D3P7X4
Position
pAB510e:complement(526215..526877)
Genome map
AA seq 220 aa AA seqDB search
MSGMLHRRWDAILFDFDGVLADSNGLKGEAFVTLYADEGPEVQAAIHAYHRANGGMARRE
KLMRFEREVLGRDIEPERLDRLVDAFAAAVEQAVVGCAEIPGAAAFLAAHADRPPLFIIS
ATPHQEMLRIVAGRGMAHHFVSVHGSPPRKAETAAMLLARHGFRADRVAFVGDAVQDYAA
AAELSLPFVGVRDRSGGHPFPDGTPTIDSLHDLSAALATL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcatgttgcaccgtcgctgggacgcgatcctgttcgacttcgacggcgtgctg
gccgattccaacggcctgaagggcgaggccttcgtcactctctacgccgacgaggggccg
gaggttcaggccgccatccacgcctatcaccgcgccaatggcggcatggcccggcgggag
aagctgatgcgcttcgagcgcgaggtgcttggccgcgacattgaaccggagcggctcgac
cggctggtcgatgccttcgccgccgcggtggagcaggcggtggtcggctgcgccgaaatt
cccggcgccgcggcttttctggcggcgcatgccgaccgcccacccctgttcatcatctcc
gcgacaccgcaccaggagatgctgcggatcgtcgccgggcggggcatggcccaccatttc
gtgtcggttcacggcagcccgccacgcaaggcggaaacggcggcgatgctgctggcccgc
catggcttccgggcggaccgcgtcgccttcgtcggcgacgccgttcaggattacgcggcg
gcggcggaactgtcgctacccttcgttggcgtgcgcgaccggtccggcgggcatcccttc
ccggacggcacccccaccatcgacagcttgcatgatctgagcgcggcgctggcgacactg
tag

DBGET integrated database retrieval system