KEGG   Azospirillum sp. B510: AZL_e04090Help
Entry
AZL_e04090        CDS       T01169                                 

Definition
(GenBank) fatty acid CoA ligase
  KO
K18661  
malonyl-CoA/methylmalonyl-CoA synthetase [EC:6.2.1.-]
Organism
azl  Azospirillum sp. B510
Pathway
Valine, leucine and isoleucine degradation
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZL_e04090
Enzymes [BR:azl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     AZL_e04090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
pAB510e:complement(526874..528403)
Genome map
AA seq 509 aa AA seqDB search
MTENFFDIAAARFPDTADSLFIELESGRRYSYRDLMEISGRYARLLTGLGVVKGDRVAVQ
VEKSAEAVFLYLACLRAGAAYLPLNTAYTKAEVAYFLGDAEPRLFVCAPDKEAMLADTAA
AAGVGTLLTLGADGDGSLTERAAGLDPAFETVACAADDLAAILYTSGTTGRSKGAMLSHR
NLSANAATLHRIWGFRPDDLLLHALPIFHTHGLFVATNCVLMNGGAMLFLPKFDADAVFR
LLPRATVMMGVPTFYTRLLADPRLTAEATAHMRLFISGSAPLLADTHREFAERTGQAILE
RYGMTETGMLTSNPLDGERIPGTVGFPLPEVSVRVADEKSGEPVPEGGIGVLEVKGPNVF
SGYWRMPEKTAQEIRPGGWFITGDVGRIDGRGYVHIIGRAKDLVISGGFNVYPKEVETVI
DAIAGVVESAVIGVPHPDFGEAVMAVVLRRPGAAGDGVDETAVIAACKERLANFKVPKAV
TFLDELPRNAMGKVQKNLLRERFKDRFAG
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaatttcttcgacatcgccgccgcacgctttcccgacaccgccgacagcctc
ttcatcgagctggagtccggccgtcgctacagctatcgcgacctgatggagatcagcggc
cgctatgcccggctgctgaccgggctgggcgtggtcaagggcgaccgcgtcgccgtccag
gtggagaaatcggcggaggcggtctttctctatctcgcctgcctgcgcgccggggcggcc
tatctgccgctgaacaccgcctacaccaaggcggaggtcgcctatttccttggcgatgcc
gaacccaggctgttcgtctgcgcgccggacaaggaggcgatgctggccgacaccgcggcg
gcggccggggtgggcacgctgttgacgctgggcgccgacggtgacggcagcctgacggag
cgggcggctgggctggatccggccttcgagacggtggcttgcgcggcggacgatctggcg
gcgatcctctatacctccggcaccaccgggcggtcgaagggggcgatgttgagccaccgc
aacctgtccgccaacgccgccaccctgcatcgcatctggggcttccgccctgacgacctg
ctgctgcacgccctgccgatcttccacacccacggcctgttcgtcgccaccaactgcgtg
ctgatgaacggcggcgccatgctgttcctgccgaaattcgacgccgacgccgtgttccgc
ctgctgccgcgcgccaccgtgatgatgggggtgccgaccttctacacccgcctgctggcc
gacccgcgcctgacggcggaggcgacggcgcatatgcggctgttcatctccggctccgcc
ccgctgctggccgacacccaccgggagttcgccgagcgcaccggtcaggccatcctggag
cgttacggcatgacggagaccgggatgctgacctccaacccgctggacggcgagcgcatt
cccggcaccgtcggctttccgttgcccgaggtgtcggtgcgggtcgccgacgagaagagc
ggcgagccggttcccgagggcgggatcggcgtgctggaggtcaaggggccgaacgtcttt
tcgggctattggcggatgccggagaagacggcgcaggaaatccggcccggcggctggttc
attaccggcgatgtcggcaggatcgacgggcgcggctatgtccacatcatcggccgggcc
aaggatctggtgatctccggcggcttcaacgtttatcccaaggaggtcgagacggtgatc
gacgccatcgccggcgtggtggaatcggcggtgatcggcgttccccatcccgatttcggc
gaggcggtgatggcggtcgtcctgcgccggccgggtgctgccggggatggtgtcgacgag
acggcggtgatcgccgcctgcaaggagcggctggccaacttcaaggtgccgaaggcggtg
accttcctcgacgaactgccgcgcaacgccatgggcaaggtgcagaagaacctcctgcgc
gagcgtttcaaggatcggttcgcgggatga

DBGET integrated database retrieval system