KEGG   Azospirillum sp. B510: AZL_e04100Help
Entry
AZL_e04100        CDS       T01169                                 

Definition
(GenBank) hypothetical protein
Organism
azl  Azospirillum sp. B510
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase
Motif
Other DBs
NCBI-ProteinID: BAI76755
RhizoBase: AZLe04100
UniProt: D3P7X6
Position
pAB510e:528761..531775
Genome map
AA seq 1004 aa AA seqDB search
MSAKDPNATEPGQTPPCFDCATDATGRLDEMFIVMGQMKNIALGQKPAQREVFRKLHGAA
HGRLVMDPKRPEALRVGVFAKDELPAWMRFSSDTSPTAPDLGSTLGIGLKVWGVDGVNAL
GETGDVADFIMQNYPVFFVDNAQEMCEFTYAGIVQNDYPGYLAKHPKTNDILNAMSAQVD
GSVLTTQYWAILPFAFGPDHYAKYALVPEVPPPGHPAVNVPTDDNNYLATDLANRLRDDE
YRFTFMVQVVPKSAGYPLDKATEEWPTDTYPYQPVATLILPKQDVSARGQGDYGQELAFN
IWRTPVEQTPQGSIAAARKVVYNHGADVRHQANGQPLEQPLVPRTPAPAPPKDDCIVKAV
IYPPIGVARIGNAPKGHVVGPEVPNPKPLMASDDPARNPYRDAEGRLLPQAARFRIYGVN
ALGRIVRELSAPDSGADITWKVHLANKKSAWYGFQLALDIPEAASADPTTLRNPTVSDRE
ALVLDAGEQAIHAGHGKQSRKLTAGKFMHQGEPVYLGRMWCEEGDKRLLVTGGRGFSASY
NGTKAITFGNNEGWHDDTSDGPVDAVVKLNGMELPVTPAWIVVAPPNYGPQRKSVRTMWD
LMRDVSIQAKTLPKPARPSFTNDIYPVFERMTGLQWVNAGFAAGFGWRSANDFTKPDWIE
RLNDRSLANQETRRVLKNSFRHDSVDSWSPMPWPWVYGDAMNVPPAQTPRQYTSLTQTQL
GFLDQWVAGDFDDDWGKVPVYTEFDQVPLEEQGEVLTRAALEFCLADAFHPGCEMTWPVR
ASTMYMEPFRFAHAPKGWIEPGMGAILSSDTVTIPNGPLYGQLPGGITRWMAVPWQTDTG
SCRSGYDASYDPNVPTFWPARVPNEVLTRENYALVMDATQPAQVRLAAFANRAAWVAPLG
TGSYTDQINNMIHHFDHLGVVEVNPGPTDPEGAKLFPPLIEVEDQHIPIPDEDDTVDAKA
VRAAHHTLTTRTPGPTGGGGGLRATQPVDLSRIDKVRRFPRGLR
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccaaggaccccaacgccacagagcccggccagactcccccctgcttcgattgc
gcgaccgacgccaccgggcgtctggacgagatgttcatcgtcatgggccagatgaagaac
atcgcgctgggccagaagccggcgcaacgcgaggtgttccgcaagctgcatggagccgcc
catggccggctggtgatggacccgaaacggccggaggctctgcgcgtcggtgtcttcgcc
aaggatgaactgccggcctggatgcgcttttccagcgacaccagcccaaccgcccccgac
ctaggttccacgctcggcatcggcctgaaggtctggggcgtcgacggggtcaacgcgctg
ggcgagaccggcgacgtcgccgatttcatcatgcagaactatccggtcttcttcgtcgac
aacgcacaggagatgtgcgagttcacctatgccggaatcgtccagaacgactatcccggc
tatctcgccaagcatcccaagaccaacgacattctgaacgccatgtcggcccaggtcgat
ggcagcgtgctgaccacccaatattgggcgatcctgcccttcgccttcggccccgaccat
tacgccaaatacgccctggtgccggaagtgccgccgcccggccatccggcggtcaatgtc
ccgaccgacgacaacaactatcttgccaccgacctcgccaaccggctgcgggacgacgaa
taccgcttcaccttcatggtgcaggtggtgccgaaaagcgccggctatccgctcgacaag
gcgacggaggaatggccgaccgacacatatccctatcagccggtggcgacgctgatcctg
cccaaacaggatgtctcggcccgcggccagggcgattacgggcaggagttggccttcaac
atctggcgcaccccggtggagcagacgccgcagggcagcatcgccgcggcgcgcaaggtc
gtctacaaccatggcgccgatgtccgccatcaggccaacggccagccgctggaacagccg
ctggtgccgcgcaccccggcgccggcgccgcccaaggatgactgcatcgtcaaggcggtg
atctatccccccatcggcgtcgcccgcatcggcaacgcgcccaagggccatgtcgtcggc
cccgaggtgccgaacccgaagccgctgatggccagcgacgacccggcgcggaacccctat
cgcgatgccgagggccggctcctgccgcaggcggcgcgcttccgcatctatggcgtcaac
gccctggggcggatcgtgcgcgagctgtcggctcccgacagcggcgccgacatcacgtgg
aaggtccatctcgccaacaagaaatcggcctggtacggcttccagctggcgctcgacatt
cccgaggcggcgtcggccgacccgaccaccttgcgcaacccgaccgtctccgaccgcgag
gcgctggtgctcgacgccggcgaacaggcgatccatgccggccatggcaagcagagccgc
aagctgaccgccggcaagttcatgcatcagggcgagccggtctatctcggccgcatgtgg
tgcgaggagggcgacaagcgcctgctggtcaccggcggtcgcggcttctccgcctcctac
aacggtaccaaggcgatcaccttcggcaacaacgagggctggcacgacgatacctccgac
gggccggtcgatgccgtcgtcaagctgaacggcatggaactgcccgtcacccccgcctgg
atcgtggtggccccgcccaattacggaccgcagcgcaagtcggtccgcaccatgtgggat
ctgatgcgcgacgtgtcgatccaggccaagaccctgcccaagccggcgcgcccctccttc
accaacgacatctatccggtgttcgagcggatgaccggcctgcaatgggtcaatgccggc
ttcgccgccgggttcggctggcgctcggccaacgacttcaccaagccggactggatcgag
cggctgaacgaccgcagcctcgccaaccaggaaacccggcgggtgctgaagaactccttc
cggcacgacagcgtcgacagctggtcgccgatgccctggccctgggtctatggcgacgcg
atgaacgtcccgccggcccagaccccgcgccaatacacatcgctgacccagacccagctc
ggcttcctcgaccagtgggtcgccggcgatttcgacgatgattggggcaaggttccggtc
tacaccgagttcgaccaggtcccgctggaagagcagggcgaggtcctgacccgcgccgcg
ctggagttctgtctggcggacgccttccatcccggctgcgagatgacctggccggtgcgc
gcctccaccatgtacatggagccgttccgcttcgcccatgcgcccaagggctggatcgag
ccgggcatgggcgccatcctgtcgagcgacacggtgaccattcccaatggtccgctctat
ggccagcttccgggcggcatcacccgctggatggcggtgccgtggcagaccgacaccggc
agctgccggtcgggctacgacgccagctatgaccccaacgtccccaccttctggccggcc
cgcgtccccaacgaggtgctgacccgggaaaactacgccctggtgatggatgccacccag
ccggcccaggtgcgtctggccgccttcgccaaccgcgccgcctgggtggcgccgctgggg
acgggcagctacaccgaccagatcaacaacatgatccatcacttcgatcatctcggcgtg
gtcgaggtcaatcccggcccgaccgatccggaaggggccaagctgttcccgccgctgatc
gaggtggaggaccagcacatccccatccccgacgaggatgacaccgtcgatgccaaggcg
gtgcgggccgcccaccacaccctgacgaccaggacgccggggccgaccggcgggggagga
ggcttgcgggcgacccagccggtcgatctcagccggatcgacaaggtccgccgcttcccg
cgcgggctgcggtga

DBGET integrated database retrieval system