KEGG   Azospirillum sp. B510: AZL_e04120Help
Entry
AZL_e04120        CDS       T01169                                 

Definition
(GenBank) HTH-type transcriptional regulator
Organism
azl  Azospirillum sp. B510
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_28 HTH_8
Motif
Other DBs
NCBI-ProteinID: BAI76757
RhizoBase: AZLe04120
UniProt: D3P7X8
Position
pAB510e:complement(532920..533822)
Genome map
AA seq 300 aa AA seqDB search
MEISGLAELEAVQAVARHRGFRAAAAELGMSRSALSHAIAALETRLGVRLFHRTTRSVAL
TQAGEQFVADTAPALRDIRAAIDRLSEHRTAPAGTLRINGSSGAARMIMKPVILEYLRRY
PGMTVDIVTEGKLVDIVLEGFDAGIRLAEQVPQDMIAVPLGPDLRFAVVGTPDYFAGRSM
PRTPADLAGHRCIRSRLPSGALYRWEFERRGETVAIDGTGPLILDDPNLMLDAVRGGLGL
GYLAEWHVAEDIAAGRLLRVLEDWTPPFPGLCLYYPGRRHLPLGLRALVDLVRELGDYSL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggaaatatccggactggcggagctggaggcggtgcaggccgtcgcccgtcatcgcggc
tttcgggcggcggcggcggaactcgggatgtcgcgctcggccctcagccatgccatcgcg
gcgctggagacgcggctgggggtgcggctgttccaccgcacgacgcgcagcgtggcgttg
acgcaggcgggggaacagttcgtcgccgataccgccccggccctgcgcgatatccgcgcc
gcgatcgaccggttgtccgagcatcggaccgcgcctgcgggaacgctgcgcatcaacggc
tcgtccggcgcggcgcggatgatcatgaagccggtcatcctggagtatctgcgccgttat
cccgggatgacggtggacatcgtcaccgaagggaagctggtcgacatcgtgctggaaggc
ttcgatgccggcatccggctggccgagcaggtgccgcaggatatgatcgccgtcccgctc
ggtcccgacctgcgcttcgccgtcgtcggaacgccggactatttcgccggccgctccatg
ccgcggaccccggccgacctcgccgggcatcgctgcatccgcagccgcctgccgagcggc
gccctctatcgctgggagttcgagcgtcgtggcgaaacggtcgccatcgacgggaccggc
ccgctgatcctggacgatcccaatctgatgctcgacgcggttcgcggcgggttggggctg
ggctatctggcggaatggcatgtcgccgaggacatcgccgccgggcggctgctgcgcgtg
ctggaggactggacgccgcccttccccggcctgtgcctctattatccgggccgacgtcat
ttgccgttggggctgcgggcgctggtggatctggtgcgggagctcggggattattcgctg
tga

DBGET integrated database retrieval system