KEGG   Azospirillum sp. B510: AZL_f01380Help
Entry
AZL_f01380        CDS       T01169                                 

Definition
dTDP-4-dehydrorhamnose epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
azl  Azospirillum sp. B510
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    AZL_f01380
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AZL_f01380
Enzymes [BR:azl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     AZL_f01380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510f:180818..181234
Genome map
AA seq 138 aa AA seqDB search
MTFLTPLKRIPTPKGEVRHGIRVDDAGFAGFGEAYISEIFSGETKGWKRHRLMTMNLIVL
KGTINFSVYDESSNECKKFLLSEENKHLYYRLTVPPGLWMAFRGEAMGSSLVLNIASHVH
DPDEAEVREINEFREFRP
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgacttttttgactcccttgaaacgtattcccactccaaaaggcgaagtacggcacgga
ataagggtcgatgacgcaggttttgcaggatttggagaggcttacataagtgaaatattt
tcaggagaaacaaaaggttggaagcgtcaccgtttaatgaccatgaatttgattgttttg
aaaggtactatcaatttctctgtttatgatgaatcctcgaacgagtgcaaaaaatttctc
ctctcagaagagaataaacatttatattatcgtctcactgtaccacctgggctctggatg
gcattccgtggagaagcaatgggaagcagtctggtattaaatattgcaagccacgtccat
gatccagatgaagcagaggtcagagaaatcaatgaatttagagaattccgtccttaa

DBGET integrated database retrieval system