KEGG   Azospirillum sp. B510: AZL_f01780Help
Entry
AZL_f01780        CDS       T01169                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
azl  Azospirillum sp. B510
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:azl00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:azl00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510f:250129..250680
Genome map
AA seq 183 aa AA seqDB search
MDVVSLDIPDVKIIRPKKFGDHRGFFSETYNKKTFEAAGLRYDFVQDNQSLSAEVGTVRG
LHFQLPPFAQDKLLRVVRGAILDVAVDIRKDSPTFGRHVSAVISAAEWNQILVPIGFAHG
FCTLEPDTEVIYKVTNYYSPEHDRGLLWNDPELGIDWPVSADKAQLSGKDRTHPTFAQLG
DWF
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcgtttccctcgatattccggacgtaaagatcatccgcccgaagaagttcggc
gaccatcgcggcttcttctcggagacctacaacaagaagacgttcgaggcggccgggctg
cggtacgatttcgtccaggacaaccagtcgctgtcggccgaggtcggcaccgtgcgcggc
ctgcatttccagctgccgcccttcgcccaggacaagctgctgcgggtggtgcgcggcgcc
atcctggacgtggcggtcgacatccgcaaggactcgccaaccttcggccggcatgtcagc
gcggtgatcagcgccgcagaatggaaccagatcctggtgccgatcggcttcgcccacggc
ttctgcacgctggagccggacaccgaggtcatctacaaggtgaccaactattattcgccc
gagcatgaccgcggtctcctgtggaacgacccggaactcggcatcgactggccggtctcc
gcggacaaggcccagctttcgggcaaggatcgcacgcacccgaccttcgcccagcttggc
gattggttctga

DBGET integrated database retrieval system