KEGG   Azoarcus sp. BH72: azo0111Help
Entry
azo0111           CDS       T00441                                 

Gene name
adhA
Definition
(GenBank) putative alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00010  Glycolysis / Gluconeogenesis
azo00071  Fatty acid degradation
azo00350  Tyrosine metabolism
azo00625  Chloroalkane and chloroalkene degradation
azo00626  Naphthalene degradation
azo01100  Metabolic pathways
azo01110  Biosynthesis of secondary metabolites
azo01120  Microbial metabolism in diverse environments
azo01130  Biosynthesis of antibiotics
azo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    azo0111 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    azo0111 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    azo0111 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    azo0111 (adhA)
   00626 Naphthalene degradation
    azo0111 (adhA)
Enzymes [BR:azo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     azo0111 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N_2 ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: CAL92729
RhizoBase: azo0111
UniProt: A1K1M4
Position
128838..129824
Genome map
AA seq 328 aa AA seqDB search
MRAMVLDTPGQPLRPAVLPQPTPGPGQVLLKVEACGVCRTDLHLVDGELPEPRLPVVPGH
EIVGRVVATGPGVTALRIGQRAGVPWLGWTCGECSYCRGGHENLCDAARFTGYTLDGGYA
EYTVADQRYCFPLPDPLPAVELAPLLCAGLIGYRALAMAGDAERIGIYGFGAAAHILAQV
LVHQGRAFYAFTRPGDLAGQGFACRLGAAWAGGSDEAPDQALDAALIFAPAGPLVPAALR
AVRKGGTVVCAGIHMSDIPAFPYDILWGERVLRSVANLTRADGERFLRIVADNPVRSHVQ
VYRLDQANEALDALRLGRIEGAAVLVPE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgatggtgttggatacccccggccagccgctgcggcccgcggtgctgccgcag
ccgacgcccggcccgggccaggtactgctgaaggtggaagcctgcggcgtgtgtcgcacc
gatctgcacctggtcgacggcgaattgcccgagccgcgcctgccggtggtgccgggccac
gagatcgtcggccgcgtcgtcgccaccgggcccggtgtcaccgcactgcgcatcggccag
cgcgccggcgtgccgtggctgggctggacctgcggcgaatgcagctattgccgcggcggc
cacgagaacctgtgtgacgccgcacgcttcaccggctacacgctggacggcggctacgcg
gaatacaccgtggccgaccagcgttactgctttccgctgcccgacccgctgccggcggtg
gaactggcgccgctgctgtgcgccggcctgatcggctaccgcgcgctggcgatggcgggc
gacgctgagcgcatcggcatctacggcttcggcgccgcggcccacatcctcgcccaggtg
ctggtgcatcaagggcgcgccttctatgccttcacccgtccgggcgatctcgccggccag
ggctttgcctgccgtctcggtgcggcctgggccggcggcagcgacgaggcgcctgaccag
gcgctggacgcggcgctgatcttcgcccccgccggcccgctggtgccggccgcgctgcgg
gcggtgcgcaagggcggcaccgtggtctgcgccggcatccacatgagcgatatccccgcc
ttcccgtacgacatcctgtggggcgagcgcgtgctgcggtccgtcgccaacctcacccgc
gcggacggcgaacgcttcctccggatcgtggccgacaacccggtgcgcagccacgtgcag
gtctatcggctggaccaggccaacgaagcgctggacgcgctgcggctggggcggatcgaa
ggggcggcggtgctggtgccggagtga

DBGET integrated database retrieval system