KEGG   Azoarcus sp. BH72: azo0413Help
Entry
azo0413           CDS       T00441                                 

Gene name
exsB
Definition
(GenBank) conserved hypothetical ExsB protein
  KO
K06920  
7-cyano-7-deazaguanine synthase [EC:6.3.4.20]
Organism
azo  Azoarcus sp. BH72
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    azo0413 (exsB)
Enzymes [BR:azo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.20  7-cyano-7-deazaguanine synthase
     azo0413 (exsB)
Transfer RNA biogenesis [BR:azo03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    azo0413 (exsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
complement(439455..440141)
Genome map
AA seq 228 aa AA seqDB search
MTDLPRAVVLLSGGLDSATCLAIARDMGLETYALSVAYGQRHAAELTASRRVAHALGARE
HRVASVSLGEFGGSALTDPAIAVPEDAAPGGIPVTYVPARNTVMLSMALAWAEVLGARHI
FVGVNAVDYSGYPDCRPAFIQAFETMANLATKAGVEGHPTTIHAPLIDLSKADIIRRGVA
LGVDYGLTVSCYQADDDGRACGRCDACRLRREGFAAAGIADPTRYQAR
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctcccgcgcgccgtcgtcctgctgtcgggcggactcgactcggcgacctgc
ctcgccatcgcccgcgacatggggctggaaacctatgccctgtcggtcgcctacggccag
cgccacgccgcggaactcacggcctcgcggcgcgtcgcccacgcgctcggcgcccgcgaa
catcgcgttgccagcgtcagcctcggcgagttcggcggctcggcgctgaccgatccggcg
atcgccgtgcccgaagatgccgcgcccggcggaattccggtcacctatgtaccggcgcgc
aacaccgtgatgctgtcgatggcgctcgcgtgggccgaagtgctgggcgcgcgccatatc
ttcgtcggcgtcaacgcggtggattattccggctatccggattgccgcccggccttcatc
caagccttcgagaccatggccaacctcgccaccaaggcgggcgtcgagggccatccgacc
acgatccacgcgccgctgatcgacctgtcgaaggccgacatcatccgtcgcggggtggcg
ctcggggtggattacggcctcacggtgtcgtgctaccaggccgacgacgacggccgcgcc
tgcggccgctgcgacgcctgccggctgcgccgcgagggcttcgccgcggccggcatcgcc
gatcccacgcgctaccaggcgcgctga

DBGET integrated database retrieval system