KEGG   Azoarcus sp. BH72: azo0465Help
Entry
azo0465           CDS       T00441                                 

Gene name
fadB1
Definition
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase (EC:5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
azo  Azoarcus sp. BH72
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    azo0465 (fadB1)
   01212 Fatty acid metabolism
    azo0465 (fadB1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    azo0465 (fadB1)
   00650 Butanoate metabolism
    azo0465 (fadB1)
  Lipid metabolism
   00071 Fatty acid degradation
    azo0465 (fadB1)
   01040 Biosynthesis of unsaturated fatty acids
    azo0465 (fadB1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    azo0465 (fadB1)
   00310 Lysine degradation
    azo0465 (fadB1)
   00380 Tryptophan metabolism
    azo0465 (fadB1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    azo0465 (fadB1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    azo0465 (fadB1)
   00281 Geraniol degradation
    azo0465 (fadB1)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    azo0465 (fadB1)
Enzymes [BR:azo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     azo0465 (fadB1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     azo0465 (fadB1)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     azo0465 (fadB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
499899..501935
Genome map
AA seq 678 aa AA seqDB search
MNAVADLARSDWHHWRIERSPDAILWLWLDRAGASANTLSAAVLDEFEVVLAALEANLPA
ALVIASAKPAGFVAGADIEEFSALPDPHAARALVERGWRLFDRLAALRCPTLALIRGHCM
GGGLELALACRYRLVVDEPATRLALPEVMLGIVPAWGGMRRLPALIGPVAALDMMLTGRS
LDARRARRIGLADDCVPPRVMENAARVLVSSGQRPALPGLLARLLNGPLKPLVAARAQRQ
TAARVSRAHYPAPFAIIDIWARHGGNALAVPAGDPASLETIFASPTAHNLARVFFLRERL
KGFGKQAAFAPRQVHVVGAGIMGGDIAAVCALAGLRVTLQDQGVDRIAPAIARAARLFER
RLRGDARAQRLALDRLIPDPQGRGVAAADLVIEAISENLDAKRALFADLEARARPDALLA
TNTSSLRLADIAAGMRTPARLVGIHFFNPVAKMPLVEVVSAAATAAEDAARAAAFVRLLD
KLALPVRDVPGFLVNAALAPYMLEALRCVEEGVAPAVVDAALTRFGMAMGPVELVDTVGL
DVALAAGKALAAGAEVPPQLAARVAEGKLGRKTGEGYYRWAPQPGGEARIVGRAPVEAVP
EGLAERVLAPLLAAVRHSVAEGVVADADLADAGLIFGAGFAPWTGGPLHHAQGRDFRIGA
SAAKQQTGPAPTTQQVSR
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcggtggctgatctcgcccgcagcgactggcatcactggcgcatcgagcgcagc
ccggacgcgatcctgtggctgtggctggaccgggccggcgccagcgccaacaccctgtcg
gccgcggtgctggacgaattcgaggtggtgctggcggcgctggaggccaacctgccggcg
gcgctcgtcatcgcttccgccaagccggccggcttcgtcgccggggccgacatcgaggag
ttctccgcactgccggatccgcatgcggcgcgcgcgctggtcgaacgcggctggcgcctg
ttcgaccgcctcgccgcgctgcgctgcccgacgctggcgctgatccgcggccactgcatg
ggcggcgggctggagctggccctggcctgccgctaccgcctggtggtggacgagcccgcc
acccggctcgcgctgccggaggtaatgctcggcatcgttccggcctggggcggcatgcgc
cgcctgccggcgctgatcggtccggtggccgcgctcgacatgatgctcaccggccgcagc
ctcgatgcgcgccgcgcgcgccggatcggcctcgcggacgactgcgtgccgccgcgggtg
atggaaaacgccgcccgcgtgctggtcagctcgggccagcgtccggccttgcccggcctg
ctcgcgcgcctgctcaacgggccgctgaagccgcttgtcgcggcgcgcgcgcagcgccag
acggcggcccgcgtcagccgcgcgcactaccccgcgccgttcgcgatcatcgacatctgg
gcgcgccacggcggtaatgcgctggccgtgccggcgggcgatccggcctcgctggagacg
atcttcgcctcgcccaccgcgcataacctggcgcgcgtgttctttctgcgcgagcggttg
aaaggcttcggcaagcaggcggcgttcgcgccgcgccaggtgcacgtggtgggcgccggc
atcatgggcggcgacattgccgcggtgtgcgcgctggccgggctgagggtgacgctgcag
gaccagggcgtggaccggattgcgccggccatcgcgcgcgccgcgcggctgttcgagcgc
cgcctgcgcggcgacgcgcgcgcgcagcggctggcgctggaccggctgatccccgatccg
caggggcgcggggtggccgcggccgacctcgtgatcgaggcgatcagcgaaaacctcgat
gccaagcgtgcgctgttcgccgacctggaagcccgtgcccgaccggacgcgctgctcgcc
accaacacctccagcctgcggctggccgacatcgccgccggcatgcgcacgccggcgcgg
ctggtgggcatccattttttcaatccggtggcaaagatgccgctggtcgaggtggtgagc
gccgcggccaccgcggcggaggatgcggcgcgcgcggccgccttcgtccgcctgctcgac
aagctggcgctgccggtgcgcgatgtgcccggcttcctggtcaacgccgcgctggcgccc
tacatgctggaagcgctgcgctgcgtcgaagagggcgtggcgcccgcggtggtggatgcg
gcgctgacccgcttcggcatggcgatgggcccggtggaactggtcgacaccgtcgggctg
gacgtggcgctggcggccggcaaggccttggctgcgggggccgaggtgccgccgcaactg
gcggcgcgggtggccgaaggcaagctcgggcgcaagacgggcgagggctattaccgctgg
gcgccgcagccgggcggggaggcgcgcatcgtcgggcgcgcgccggtggaggcggtgccg
gagggactggccgagcgcgtgctcgccccgctgttggcggcggtgcggcacagcgtggcc
gaaggcgtggtggccgatgccgacctcgccgacgcggggctcatcttcggggcgggtttc
gcaccctggacgggcggtccgctgcatcatgcgcaggggcgcgatttccggattggcgcc
tctgctgcaaagcagcaaactggaccggctcctacaacacaacaggtatcgcgatga

DBGET integrated database retrieval system