KEGG   Azoarcus sp. BH72: azo0602Help
Entry
azo0602           CDS       T00441                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
azo  Azoarcus sp. BH72
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:azo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    azo0602 (ruvA)
Enzymes [BR:azo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     azo0602 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(629785..630384)
Genome map
AA seq 199 aa AA seqDB search
MIGRISGLLLEKNPPQILVDAHGVGYELEVPMSTFYGLPATGTQVSLHTHLAIREDGHFL
YGFATDEERTAFRQLLKVSGIGARTALAVLSGLSVSDLAQAVALQEAGRLVKIPGIGKKT
AERLLLELRDKLGKALPQVAGARLAAVAGGAPDAKSDILNALLALGYNEKEALGAMKGLA
EDTGVSDGIRQALKLLSKA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacgcatcagcggcctgctgctcgaaaagaacccgccgcagatcctggtcgac
gcccacggcgtcggctacgaactcgaagtgccgatgagcaccttctacggcctgcccgcc
accggcacccaggtcagcctgcacacccacctcgcgatccgcgaggacggccacttcctg
tacggcttcgccaccgacgaggagcgcaccgcattccgccagttgctcaaggtctccggc
atcggcgcgcgcaccgcgctcgcggtgctgtcggggctgtcggtgtccgacctcgcgcag
gcggtggcgctgcaggaagccggacggctggtgaagattcccggtatcggcaagaagacc
gcggaacgcctgctgctggagctgcgcgacaagctcggcaaggcgttgccgcaggtcgcc
ggcgcgcggctggccgcggtcgcagggggtgcgccggacgcgaagagcgacatcctcaat
gcgctgctcgcgctcggctacaacgagaaggaagcgctcggcgcgatgaagggcctggcc
gaggacaccggcgtctccgacggcatccgccaggcgctcaagctgctgtccaaggcctga

DBGET integrated database retrieval system