KEGG   Azoarcus sp. BH72: azo0623Help
Entry
azo0623           CDS       T00441                                 

Gene name
matA
Definition
putative malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
azo  Azoarcus sp. BH72
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    azo0623 (matA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    azo0623 (matA)
Enzymes [BR:azo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     azo0623 (matA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(651269..652651)
Genome map
AA seq 460 aa AA seqDB search
MSATGLISKSLSRVRAMVAEAAGRNREPSVRTLERIRQQLRECAEGRGGEVSTRQRAARL
ADTYLSLDDGGRLAFLRIIALEFGPDPAKVASAHKAYQAAIGTDRQWDSEAALRAAMRSQ
RLRILTQFNAIPQGVKFLVDLRADLLRFLADEPLLKPLDRELEARLAAWFDVGFLELARI
TWNSPAALLEKLVQYEAVHEIRSWRDLKNRLDSDRRCYAFFHPRMPLEPLIFVEVALVEE
LADNVQKLLDENAPVADPARASAAIFYSISNTQAGLRGVSFGNFLLKRVVEDLQRDYPRL
HTFATLSPIPGLVGWMRRHPEQLAEAFTPNDWKRLAALGIEGPDAPALRALLSAPREAMA
DTQLQRALREPLLRVAAYYLLNAARDGKPVDPVARFHLGNGARVERLNWLADTADKGHEQ
SWGMMVNYLYDPDRIEANLESFASEGRVDASASVRRLARR
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaccggcctcatctcgaaaagcctgtcgcgcgtgcgcgccatggtcgccgaa
gcggctggccggaaccgggaaccgtccgtccgtacgctcgaacgcatacgccagcaactg
cgcgaatgcgccgaaggccgcggcggcgaagtatccacccgccagcgcgccgcccggctc
gccgatacctatctgagcctggacgacggcggtcgcctcgccttcctgcgcatcatcgcg
ctcgaattcggccccgaccccgccaaggtggcgagcgcacacaaggcctaccaggcggcc
atcggcaccgatcgccagtgggactccgaagcggcgctgcgtgcggcgatgcgttcccaa
cgcctgcgcatcctcacccagttcaacgccattccgcagggcgtcaagttcctggtcgat
ctgcgtgccgacctgctccgcttcctcgccgacgagccgctgctcaagccgctcgaccgc
gaactcgaggcgcgcctggcagcatggttcgacgtcggcttcctcgaactcgcccgcatc
acgtggaactcccccgcggcgctgctcgaaaagctcgtccagtacgaagcggtccatgag
atccgctcgtggcgcgacctcaagaaccggctcgactccgaccgccgctgctatgcgttc
ttccacccccggatgccgctcgaacccttgatcttcgtcgaggtggcgctggtggaggaa
cttgccgacaacgtccagaagctgctcgacgaaaacgcgcccgtggccgaccccgcgcgc
gccagcgccgcgatcttctactcgatcagcaacacccaggcgggcctgcgcggggtgtcc
ttcggcaacttcctgctcaagcgcgtggtggaagacctgcagcgcgactatccgcgcctg
cacacctttgccaccctgtcgcccattccgggcctggtgggctggatgcggcgccacccc
gaacagctcgccgaagccttcacgcccaacgactggaaacgcctcgccgcgctcggcatc
gaagggcctgacgcgcccgcgctgcgtgccctgctgagcgcgccgcgggaggcgatggca
gacacgcaactgcagcgcgcgctgcgcgaacccctgctgcgggtggccgcgtactacctg
ctcaacgccgcgcgcgacggcaagcccgtggatccggtcgcccgctttcacctcggcaac
ggcgcccgcgtcgagcgcctcaactggctcgccgacaccgccgacaagggccacgagcag
tcgtggggcatgatggtgaactacctgtacgaccccgaccgtatcgaggccaacctggag
tccttcgccagcgaaggccgcgtcgacgcctcggcctcggtccgtcgcctcgcgcggcgc
tga

DBGET integrated database retrieval system