KEGG   Azoarcus sp. BH72: azo0724Help
Entry
azo0724           CDS       T00441                                 

Gene name
dsbC
Definition
putative protein disulfide-isomerase (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
azo  Azoarcus sp. BH72
Brite
Enzymes [BR:azo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     azo0724 (dsbC)
Secretion system [BR:azo02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   azo0724 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
777226..777951
Genome map
AA seq 241 aa AA seqDB search
MVALKSAGRFALVIAFGLLPTLVAAGEEDVRKGVDAFIGSAAVESVTRTPYAGLYEVVLK
SGEIIYTDDKTSFIMDGRVIDTRTRRDLTQAKLNQLSSIDFSTLPLDQAVKQVKGNGKRV
IATFEDPNCGYCKRLAKELAQMPDVTIYTFLYPILSQDSTAKSRSIWCSKDRAKAWNDWI
VSGKAPSGDDCNSAVVDRNVELGQKLRINGTPTIFLSDGTRIGGFVQLPELEKALARVTP
R
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggtggcgttgaaatccgcgggccgattcgcgctcgttattgcgttcggattgcttccg
acgcttgttgcagccggcgaggaagatgtgcgcaagggcgttgatgccttcatcggatcg
gcggcggtggagtccgtgacacgcacgccctatgctggcctctacgaggtcgtgttgaag
agcggagagatcatctacaccgatgacaagaccagcttcatcatggatggtcgcgtcatc
gatacccgcacgcgccgcgaccttacgcaagccaagctcaaccaactgtcctccattgat
ttctcgacactgccgctggaccaggcggtgaagcaggtgaagggaaatggaaagcgtgtg
atcgcaacgttcgaagatccgaactgcggctattgcaagcgtctggcaaaagaactcgcg
cagatgccggacgtgacgatttacacgttcctctatccgattctcagtcaggactccacc
gcgaagtcgcggagcatctggtgctccaaggaccgggccaaggcctggaatgactggatc
gtcagcgggaaggcgccgagcggcgacgactgcaattccgcggtcgtggaccgcaatgtg
gaactgggccagaaactgcggatcaacggcacgccgacaatttttctgtccgacggcacg
cggattggcggcttcgtccagttgcccgaactcgaaaaggcgctcgcccgcgtgacgcct
cgttga

DBGET integrated database retrieval system