KEGG   Azoarcus sp. BH72: azo0818Help
Entry
azo0818           CDS       T00441                                 

Gene name
hisD
Definition
(GenBank) HisD protein
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00340  Histidine metabolism
azo01100  Metabolic pathways
azo01110  Biosynthesis of secondary metabolites
azo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    azo0818 (hisD)
Enzymes [BR:azo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     azo0818 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh UCMA
Motif
Other DBs
NCBI-ProteinID: CAL93435
RhizoBase: azo0818
UniProt: A1K3N0
Position
872987..874297
Genome map
AA seq 436 aa AA seqDB search
MSFATPIRRLDARQPDFLATLDALLAFESEADERIDSAVTEILRAVRSTGDAAVMEYTRR
FDHVEAKSMVELELPKAELQAALDSLTVEQREALRIAADRVRIYHERQRAESWDYVEADG
SRLGQKVTPLDRVGLYVPGGRASYPSSVLMNAIPAKVAGVEELIMVVPTPRGEKNPLVLA
AAAITGVDRVFTIGGAQAVAALAYGTQTIPQVDKIVGPGNAFVAEAKRRVFGTVGIDMVA
GPSEVLIISDGSGHADWVAMDLFAQAEHDELAQSILLCTDAGFLDAVHAAIDRLLPTMPR
RETIARSLANRGALIHVGSLEQACAIANRIAPEHLELSMEDAERWIDAIRHAGAIFVGHW
AVEALGDYCAGPNHVLPTMRSARFSSPLGVYDFQKRTSIVQISEAGAQHLGKIASVLAHG
EGLQAHARSAEMRLKV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcgcgaccccgatccgccgtctcgatgcccgccagcccgatttcctcgcgacg
ctggatgcgctgctggcgttcgaaagcgaggccgacgagcgcatcgacagcgcggtcacc
gagatcctgcgcgcggtgcgcagcaccggcgacgccgcggtcatggaatacacccgccgc
ttcgatcatgtcgaggcgaaatcgatggtcgagctggagctgcccaaggccgaactgcag
gccgcgctcgacagcctgaccgtggagcagcgcgaggcattgcgcatcgccgccgaccgc
gtgcgcatctaccacgagcgccagcgcgccgagtcctgggactatgtcgaggccgacggt
tcgcggctgggccagaaggtgacgccgctcgaccgcgtcggcctctacgtgcccggcggg
cgcgcgtcctaccccagttcggtgctgatgaacgcgattccggccaaagtcgccggtgtc
gaggaactcatcatggtggtgccgacgccacgcggcgagaagaacccgctggtgctcgcg
gccgccgcgatcaccggcgtcgaccgggtgttcaccatcggcggcgcgcaggcggtggcg
gcgctggcctacggcacgcagaccattccgcaggtcgacaagatcgtcggtcccggtaac
gctttcgtcgccgaagccaagcgccgggtgttcggcacggtgggcatcgacatggtggcc
ggtccatccgaggtgctgatcatctccgacggttccggccatgccgactgggtggcgatg
gatctcttcgcgcaggcggagcacgacgaactggcgcagtccatcctgctgtgcaccgat
gccggttttctcgacgcggtgcacgcggcgatcgaccgtctgctgcccacgatgccgcgc
cgcgagaccatcgccaggtcgctcgcgaaccggggcgcactgatccacgtcggcagcttg
gagcaggcgtgcgcgatcgccaaccgcatcgcgccggagcacctggaactgtcgatggaa
gacgcggagcgctggatcgatgcgatccgccacgcgggcgcgatcttcgtcgggcactgg
gcggtggaggcgctgggtgactactgcgccggccccaaccacgtgttgccgaccatgcgc
agtgcgcgtttctcgtcgccgctgggggtctacgatttccagaagcggaccagcatcgtg
cagatttccgaggcgggtgcgcagcatctgggcaagatcgcgtcggtactggcccacggc
gagggcctgcaggcgcacgcccgctcggcggagatgcggctcaaggtctga

DBGET integrated database retrieval system