KEGG   Azoarcus sp. BH72: azo0824Help
Entry
azo0824           CDS       T00441                                 

Gene name
allR
Definition
(GenBank) probable negative regulator of allantoin and glyoxylate utilization operons
Organism
azo  Azoarcus sp. BH72
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
complement(882604..883407)
Genome map
AA seq 267 aa AA seqDB search
MVVKKPEPTPAAEAKNPIQVIERMMKLLDVLAHHADPVPLKQLALETGLHPSTAHRILGA
MTQSGFVERSDAGVYRLGIRLLELGSLVKSRISLRETAMPAMLKLHATTGESVNLGIRAG
DEIVYVERTSSGRSSVRVVHIVGARAPLHTTATGKLFLVEDGLERVRDYARRTGLPASTS
ASITTLPLLEKELDKVRRHAVAFDLDEVEAGVRCIAAGIRDDSGELIAGLSLSTPSERFN
PDWAPLVRDTADEISQALGWRQRRTAT
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgtcaagaagccagaacctacccccgcggcagaagccaagaaccccatccaggtc
atcgagcgcatgatgaagctgctcgacgtgctcgcgcatcacgccgatccggtgccgctg
aagcagctcgcactggaaaccgggcttcacccctccaccgcacaccgcatcctgggtgcg
atgacccagagcggctttgtcgagcgctctgacgccggcgtctaccgcctcggcattcga
ttgctggaactcggcagcctggtgaagtcgcgcatctcgctgcgcgagaccgccatgccg
gcgatgctcaagctgcatgccacgacaggcgaaagcgtcaacctcggcatccgcgccggc
gacgagatcgtctatgtggagcgcacgtcgagcggccggtcctcggtgcgggtcgtgcat
atcgtcggcgcgcgcgccccgctgcataccaccgccaccggcaagctcttcctcgtcgag
gacggtctggaaagagtccgcgactacgcccggcgcaccggcctgccggcgtccacctcc
gcctccatcaccacgctgccgctgctggaaaaggaactcgacaaggtgcgccgtcacgcg
gtggccttcgacctcgatgaagtcgaggccggcgtccgctgcattgcggccggcatccgc
gacgacagcggcgagctgatcgccgggttgtcgctgtccacgccgtcggagcgcttcaac
cccgactgggcaccgctggtgcgcgataccgccgacgagatttcgcaggcgctcggctgg
cgccaacgccgcacggcgacgtaa

DBGET integrated database retrieval system