KEGG   Azoarcus sp. BH72: azo0848Help
Entry
azo0848           CDS       T00441                                 

Gene name
pcm1
Definition
putative protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
azo  Azoarcus sp. BH72
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
913062..913715
Genome map
AA seq 217 aa AA seqDB search
MNFEKARFNMVEQQIRPWDVLDPAVLDLLMTVKREEYVPAAARALAFADVEIPLGQGQVM
LKPVIEGKILQSLQLHRSDSVLEVGAGSGYFAALLAARVEWVRTVDIEPELVRFAHANLA
RNGVENVIVEEGDAAQGWASRAPYDVIVVSGGLPVVPQALLEQLKVGGRLFAFVGEAPVM
KARLITCEAEGRFLTEDIFETLVPMLKNAPRQDSFRF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgagaaagcgcgcttcaacatggttgagcaacagatccgcccctgggatgtg
ctggatccggcagtgctcgacctcctgatgacggtcaagcgcgaggaatacgtgccggcc
gccgcccgcgcgctcgcgttcgccgacgtggagattccgctcggccagggccaggtcatg
ctgaagccggtcatcgaaggcaagatcctgcagtcgctgcaactgcaccgctccgactcc
gtgctcgaagtgggcgccggcagcggttacttcgccgcgttgcttgccgcccgcgtcgaa
tgggtgcgcaccgtcgacatcgagcccgaactggtccggtttgcccacgccaacctcgcg
cgcaacggggtcgagaacgtcatcgtcgaagagggcgatgccgcccagggctgggcgagc
cgcgcgccctacgacgtgatcgtggtgtcgggcgggctgccggtcgtgccccaggcactg
cttgaacaactgaaggtgggtggccgcctgttcgccttcgtgggcgaggcgccggtgatg
aaggcgcgcctgatcacctgcgaggccgagggccgcttcctgaccgaagacattttcgaa
accctggtgccgatgctgaagaacgcaccgcgccaggacagcttccgcttctga

DBGET integrated database retrieval system