KEGG   Azoarcus sp. BH72: azo0848Help
Entry
azo0848           CDS       T00441                                 

Gene name
pcm1
Definition
(GenBank) putative protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
azo  Azoarcus sp. BH72
Brite
Enzymes [BR:azo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     azo0848 (pcm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 MTS PrmA Met_10 Methyltransf_11 Methyltransf_23 Methyltransf_12 RrnaAD Ubie_methyltran tRNA_U5-meth_tr DUF938 Methyltransf_18 NodS ADH_zinc_N_2 Methyltransf_32 Methyltr_RsmB-F
Motif
Other DBs
NCBI-ProteinID: CAL93465
RhizoBase: azo0848
UniProt: A1K3R0
Position
913062..913715
Genome map
AA seq 217 aa AA seqDB search
MNFEKARFNMVEQQIRPWDVLDPAVLDLLMTVKREEYVPAAARALAFADVEIPLGQGQVM
LKPVIEGKILQSLQLHRSDSVLEVGAGSGYFAALLAARVEWVRTVDIEPELVRFAHANLA
RNGVENVIVEEGDAAQGWASRAPYDVIVVSGGLPVVPQALLEQLKVGGRLFAFVGEAPVM
KARLITCEAEGRFLTEDIFETLVPMLKNAPRQDSFRF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgagaaagcgcgcttcaacatggttgagcaacagatccgcccctgggatgtg
ctggatccggcagtgctcgacctcctgatgacggtcaagcgcgaggaatacgtgccggcc
gccgcccgcgcgctcgcgttcgccgacgtggagattccgctcggccagggccaggtcatg
ctgaagccggtcatcgaaggcaagatcctgcagtcgctgcaactgcaccgctccgactcc
gtgctcgaagtgggcgccggcagcggttacttcgccgcgttgcttgccgcccgcgtcgaa
tgggtgcgcaccgtcgacatcgagcccgaactggtccggtttgcccacgccaacctcgcg
cgcaacggggtcgagaacgtcatcgtcgaagagggcgatgccgcccagggctgggcgagc
cgcgcgccctacgacgtgatcgtggtgtcgggcgggctgccggtcgtgccccaggcactg
cttgaacaactgaaggtgggtggccgcctgttcgccttcgtgggcgaggcgccggtgatg
aaggcgcgcctgatcacctgcgaggccgagggccgcttcctgaccgaagacattttcgaa
accctggtgccgatgctgaagaacgcaccgcgccaggacagcttccgcttctga

DBGET integrated database retrieval system