KEGG   Azoarcus sp. BH72: azo0916Help
Entry
azo0916           CDS       T00441                                 

Gene name
tilS
Definition
(GenBank) putative tRNA(Ile)-lysidine synthetase
  KO
K04075  
tRNA(Ile)-lysidine synthase [EC:6.3.4.19]
Organism
azo  Azoarcus sp. BH72
Brite
Enzymes [BR:azo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.19  tRNAIle-lysidine synthase
     azo0916 (tilS)
Transfer RNA biogenesis [BR:azo03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    azo0916 (tilS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
981412..982758
Genome map
AA seq 448 aa AA seqDB search
MAVELAGPFAEVLRAAAIGPASRLCCALSGGVDSVVTLDLLTRLQPRFGFTLTAVHVHHG
LSPHADAWAQFCARLCAARGLTLAIRRVEVPTDTGQGLESAARARRHAELVALPCDWLVF
GHHQDDQAETVLFRLFRGSGLRGLGAMAAVEPGQHAMPGKLRPLLDIGRAGIVAYARAAG
LEWIEDESNADCRFTRNALRHKVLPVVQAQFPAVAPTLARTAALLREGADLLDDLARLDE
NACGGPVLAADVFASLPAARAANLLRWQTARMGARAPSRARLGETLRQLREAPGPLRLPL
GDLWCCAYQGRVWLERDDEAPLRAHLWCGESSLGWGAGQVRLSQGGGGAALRVAAGEAML
APPAPGLRMRLGPGRPTRSFKNLCQEAGIPPWLRPRLPVLWVAGEPAWIGGIGIAAQFQC
AEGEQGVVPAWVPASAAQQGQHLGQFDR
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtggaactcgccggaccgtttgccgaggtgctgcgcgccgcggcgatcggtccg
gcgagccgtttgtgctgcgcgctgtcgggaggcgtggattcggtcgtcaccctcgatctg
ctgacgcggctgcaaccccgcttcggtttcaccctcaccgcggtgcatgtgcaccacggt
ctcagtccgcatgccgacgcctgggcgcagttctgtgcgcggctgtgtgccgcgcgcggg
cttacgctggcgatacggcgggtcgaggtgcccacggacaccgggcaggggctggagtcg
gccgcgcgtgcgcggcgccatgcagaactcgtcgccctgccgtgcgactggcttgttttc
ggccaccatcaggacgatcaggccgagaccgtgctgttccgcctgttccgcggcagcggc
ctgcggggactgggggcgatggcggcggtggagcccggtcagcacgcaatgccgggcaag
ctgcgcccgttgctcgacatcggccgcgccgggatcgtggcctatgcgcgggccgccggc
ctggagtggatcgaggacgaaagcaacgccgactgccgcttcacccgcaacgccttgcgg
cacaaggtgcttccggtcgtccaggcgcagtttccggctgtggcgcccacgctggcgcgg
accgcggcgctgctgcgcgaaggcgccgacctgctggacgatctcgcgcggctggacgag
aacgcgtgtggcggtccggtgcttgctgcggacgtcttcgcgtcgttgccggcggcgcgg
gccgccaatctgttgcgttggcagaccgcgcggatgggggcgcgggcgccgtcgagggcc
cgcctgggcgagacgctccgccagctgcgcgaggcaccgggcccgctacgtctcccgctg
ggtgatctgtggtgttgcgcttatcagggccgggtgtggctggagcgtgatgatgaagcg
ccgctgcgcgcgcacctttggtgcggcgaatccagcctgggttggggggcggggcaggtg
aggctgagtcaggggggcgggggtgccgcgcttcgcgtggcagccggcgaggcgatgctg
gcgccgcccgcacccggtctgcgcatgcgcctcgggccagggcggcccacgcgcagcttc
aagaacctgtgccaggaggcgggcataccgccgtggctgcgcccgcggctgccggtgttg
tgggtggcgggcgagccggcctggatcggcggtattggcatcgccgcgcagttccagtgc
gcggagggggagcagggcgtggtgccggcgtgggtgccggcgtcagctgcgcagcagggt
cagcatctgggccagttcgaccgctga

DBGET integrated database retrieval system