KEGG   Azoarcus sp. BH72: azo0959Help
Entry
azo0959           CDS       T00441                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
azo  Azoarcus sp. BH72
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:azo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    azo0959 (recR)
DNA repair and recombination proteins [BR:azo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      azo0959 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1031759..1032358
Genome map
AA seq 199 aa AA seqDB search
MSSPPSSLDELIAALRCLPGVGPKSAQRMAYHLLQRDQRGAARLAGALGHALEVLRHCQR
CNNFSEEAVCQRCANPRRDPATLCVVEMPADLAMIEQTQSYNGLYYVLMGRLSPLDGVGP
RELGLERLIARATDGEVKEVILATNFTNEGEATAHTVATLLGARGVKVSRISRGVPVGGE
LEHTDTGTIAQALVERRAF
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctcctccttccagtctcgacgaactcatcgccgcgctgcgctgcctgcctggc
gtcgggccgaagtccgcgcagcgcatggcctaccacctgctgcagcgcgaccagcgcggc
gcggcgcggctggcgggggcgctcggccatgcgctcgaagtgctgcgccattgccagcgc
tgcaacaacttctccgaagaggcggtctgccagcgctgcgccaatccgcggcgcgacccc
gcgacgctctgtgtcgtcgagatgcccgccgatctggccatgatcgagcagacccagtcc
tacaacggcctgtactacgtgctgatggggcgtttgtcgccactcgacggcgtgggaccg
cgcgaactcgggctcgaacgcctgatcgcgcgtgcgaccgacggtgaggtcaaggaagtc
atcctcgcgaccaacttcaccaacgagggcgaggcgacggcgcacaccgtggccacgctg
ctcggcgcgcgcggggtcaaggtcagccgcatctcacgcggcgtgcccgtcggtggcgaa
ctcgaacacaccgacaccggcacgattgcccaggcgctggtcgagcggcgcgcgttctga

DBGET integrated database retrieval system