KEGG   Azoarcus sp. BH72: azo1047Help
Entry
azo1047           CDS       T00441                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
azo  Azoarcus sp. BH72
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    azo1047 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    azo1047 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    azo1047 (trpB)
Enzymes [BR:azo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     azo1047 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1126595..1127848
Genome map
AA seq 417 aa AA seqDB search
MRPGSPHSLPEFDMQMADTPYHYPDARGHFGRHGGVFVAETLMPALDELREAYARYSQDP
EFIAEFQYELKHYVGRPSPIYHAKRWSGILGGAQVYLKREDLNHTGAHKVNNCIGQALLA
RRMGKPRVIAETGAGQHGVATATVAARYGMECVVYMGAEDVKRQAANVYRMKLLGATVVP
VESGSKTLKDALNEAMRDWVTNVADTFYIIGTVAGPHPYPMMVRDFQAVIGDECKVQMPE
LVGRQPDQVIACVGGGSNAMGIFYPYLDVPGVKLVGVEAAGEGLQTGRHAAPLTANAPVG
VLHGNRTYLMQDEDGQIIETHSISAGLDYPGVGPEHAWLKDDGRAEYVAVTDSEALQAFH
DLCRFEGIIPALESSHALAYAAKIAPTLPKDHVLLVNLSGRGDKDMHTVAERSGIQF
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgcggccaggatcgccgcattcgttgccggagttcgacatgcagatggctgacacgcct
taccactatcccgacgcccgcggccatttcggccggcacggcggcgtcttcgtcgccgaa
acgctgatgccggccctcgacgagctgcgcgaggcctatgcccgctacagccaggatccc
gagttcatcgcggagttccagtacgaactcaagcactacgtcggccggcccagtccgatc
taccacgccaagcgctggtcgggcatcctcggcggtgcgcaggtctatctgaagcgcgaa
gacctcaatcacaccggcgcgcacaaggttaacaactgcatcggccaggcgctgctcgcc
cgccgcatgggcaagccgcgggtgattgccgaaaccggcgccggccagcacggcgtcgcc
accgccaccgtcgctgcccgctacggcatggagtgcgtggtctatatgggtgccgaggac
gtcaagcgccaagccgccaacgtctatcgcatgaaactgctcggcgccaccgtggtgccg
gtcgagtccggctccaagaccctgaaggacgcgctcaacgaagccatgcgcgactgggtg
acgaacgttgccgataccttctacatcatcggcaccgtggcggggccgcacccctacccg
atgatggtgcgcgacttccaggcggtgatcggcgacgagtgcaaggtgcagatgccggaa
ctggtcggccgtcagcccgatcaggtcatcgcctgcgtgggcggcggttcgaacgcgatg
ggtatcttctacccctacctcgatgtgcccggcgtcaagctggtcggcgtcgaggcggca
ggcgagggcctgcagaccggccgtcacgccgctccgctgacggcgaacgcgccggtgggc
gtgctgcacggcaaccgcacctacctgatgcaggacgaggacggccagatcatcgaaacg
cactcgatctcggccggtctcgactaccccggcgtcggccccgaacatgcctggctgaag
gatgacgggcgcgccgagtacgttgccgtgaccgacagcgaggcactgcaggccttccac
gacctgtgccggttcgaggggatcatcccggcgctggagtcctcgcacgcgctggcgtac
gccgccaagatcgcccccaccctgccgaaggatcacgtcctgctggtcaatctctccggg
cgtggcgacaaggacatgcacaccgtcgccgaacgctccggcatccagttctga

DBGET integrated database retrieval system