KEGG   Azoarcus sp. BH72: azo1048Help
Entry
azo1048           CDS       T00441                                 

Gene name
trpA
Definition
(GenBank) TrpA protein
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
azo  Azoarcus sp. BH72
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    azo1048 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    azo1048 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    azo1048 (trpA)
Enzymes [BR:azo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     azo1048 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
1127891..1128706
Genome map
AA seq 271 aa AA seqDB search
MSKIQTTFQRLQAQGRKALIPFITAGDPDPTLTVPLMHALVAGGADIIELGVPFSDPMAD
GPTIQRASERALAQGMTLRKVLQAVREFRSGDADTPVVLMGYANPIEAMGQQAFVAAARE
AGVDGALVVDYPPEECVEFAAASKAAGLDPIFLLAPTSSEQRFADVARAGSGYIYYVSLK
GVTGAGTLDLDEVARRIPQIRAAVGMPVGVGFGIRDAESARRIGAVADAVVIGSRIIEEI
ERSPREQACSNVTHFVKGIREALDTLPGVKQ
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaatccagaccactttccagcgccttcaggcccagggccgcaaggcgctgatc
ccgttcatcaccgcgggcgatcccgaccccacgctgacggtgccgctgatgcatgcgctc
gttgcgggcggggcggacatcatcgagttgggggtcccgttctccgaccccatggctgac
ggcccgaccatccagcgtgcttccgagcgcgcattggcgcagggcatgaccttgcgcaag
gtgctgcaggccgtgcgcgagttccgcagcggggatgccgacaccccggtggtactgatg
ggttacgccaatccgatcgaggcgatgggccagcaggcctttgtcgccgcagcccgcgaa
gccggcgtggacggcgcgctcgtggtggattacccgcccgaagagtgcgtcgaattcgcc
gcggccagcaaggcggccgggctcgacccgatcttcctgctcgcgccgacgtcgtcggaa
cagcgctttgcggacgtcgcccgggcgggcagcggctacatctactacgtctcgctgaag
ggcgtgaccggcgctggcacgctggatctggacgaggtcgcgcgccgcattccgcagatc
cgcgctgcggtgggcatgccggtgggcgtggggttcggcatccgtgacgccgaaagcgcg
cgacggatcggcgccgtggccgatgcggtggtgatcggcagccgcatcatcgaagagatc
gaacgcagcccgcgcgagcaggcctgcagcaatgtcacccacttcgtgaagggcatccgc
gaagccctcgataccctgcccggagtcaagcaatga

DBGET integrated database retrieval system