KEGG   Azoarcus sp. BH72: azo1088Help
Entry
azo1088           CDS       T00441                                 

Gene name
pcm2
Definition
protein-L-isoaspartate (D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
azo  Azoarcus sp. BH72
Brite
Enzymes [BR:azo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     azo1088 (pcm2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1171112..1171717
Genome map
AA seq 201 aa AA seqDB search
MVERLRAQGIQDEGALAAMMQVPRHLFVEEGLAYSAYDDTALPIGFQQTISQPYVVARMI
ELLRSGGRQLGRVLEIGAGCGYQAAVLSTLATEVYAVERIRPLLDKARANLRPLRLPNVR
LKHADGTLGLPEAAPFESIIVAAAAGGVPNALKEQLAPGGRLIIPVGGGEQRLLLIERQG
NVFRESGYEAVRFVPLLAGTE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggtggagcgcttgcgcgcgcagggcattcaggacgagggggccctggcggcgatgatg
caggtgccgcgacacctgttcgtcgaggaaggcttggcgtacagcgcttacgacgatacg
gcacttccgatcggattccagcaaaccatctcccagccttacgtagtggcgagaatgatc
gaattgctgcgcagcggcgggcggcaactcgggcgtgtgctggaaatcggggcggggtgc
ggctatcaggccgcggtgctgtccacgcttgctaccgaagtctatgcagtggagcgtatc
cggccgctgctggacaaggcgcgtgcaaatctccggcccttgcgcctgcccaacgtccgc
ctcaaacatgcggacggaacgctgggtttgccggaggcggcgccctttgaaagcatcatc
gtcgcggcggccgcgggcggtgtgccgaatgccctcaaggaacaacttgccccgggcggt
cgtctgatcatcccggtcgggggtggtgaacagcgactgttgctgatcgaacgccaaggc
aacgtattcagggagagcggttacgaggcggtgcgcttcgtgccgttgcttgcaggtacc
gaatga

DBGET integrated database retrieval system