KEGG   Azoarcus sp. BH72: azo1144Help
Entry
azo1144           CDS       T00441                                 

Gene name
soxZ
Definition
phosphodiesterase I (EC:3.1.4.1)
Orthology
K17227  
sulfur-oxidizing protein SoxZ
Organism
azo  Azoarcus sp. BH72
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:azo00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1229562..1229873
Genome map
AA seq 103 aa AA seqDB search
MSNPTRIRATAKDGYTEVRVLMSHVMENGQRKDAGGVVVPAHFITEVSVTHNERVVLAAQ
FGPSVSANPYLAFRFQGGASGDRIAVRWTDNGGDSRSDEARIG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatccgacccgtatccgcgcgaccgcgaaggacggctacaccgaagtccgtgtg
ctgatgtcgcatgtgatggaaaacggccagcgcaaggacgccggcggcgtggtggtgccg
gcgcacttcatcaccgaggtgagcgtcacccataacgagcgcgtcgtgctggcggcccag
ttcggtccttcggtttcggccaacccctatctcgcgttccgcttccagggtggggccagc
ggcgatcgcatcgcggtgcgctggaccgacaacggcggcgacagccgcagcgacgaggcg
cgcatcggctag

DBGET integrated database retrieval system