KEGG   Azoarcus sp. BH72: azo1159Help
Entry
azo1159           CDS       T00441                                 

Gene name
aceB
Definition
(GenBank) AceB protein
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00620  Pyruvate metabolism
azo00630  Glyoxylate and dicarboxylate metabolism
azo01100  Metabolic pathways
azo01110  Biosynthesis of secondary metabolites
azo01120  Microbial metabolism in diverse environments
azo01200  Carbon metabolism
Module
azo_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    azo1159 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    azo1159 (aceB)
Enzymes [BR:azo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     azo1159 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: CAL93776
RhizoBase: azo1159
UniProt: A1K4M1
Position
complement(1247367..1248971)
Genome map
AA seq 534 aa AA seqDB search
MTATLDLPQGMQINAPLHPRFDQILTRDALELVAKLHRAFEPRRQELLKARVARQARIDA
GELPDFLPETKHIREGDWKVAPLPKALECRRVEITGPVERKMIINAFNSGADSYMTDFED
SNSPNWYNQIQGQVNLFDAIRREISYTNEAGKVYKLNDKIATLQIRPRGWHLDEKHVLVD
GQRVSGGIFDFALVFFHNAKEQIARGAGPFYYLPKMESHLEARLWNDIFVMAQDHIGLPQ
GTIKATVLVETILATFEMEEILYELRNHSAGLNAGRWDYIFSCIKKFKKNKDFCLANRGA
ITMEVPFMRSYALALVQACHKRGAPAMGGMSALIPIKSDPVANEKALAGIRHDKTRDAND
GYDGGWVAHPGLVPIAMEEFVKVLGDKPNQWEKQVSGSFGPKDWMNFQPEQPITEVGVRN
NINVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQIWQWVVSPKGKLDDGRKVTADMV
RAMIPEELAKVKATVTAQGENTATYDQAATIFEEMSLSENFPEFLTLPLYEAME
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccacgctcgacctgccgcaaggcatgcagatcaacgcgccgctgcatccgcgc
ttcgaccagatcctgacccgcgacgcgctggaactcgtcgccaagctgcaccgcgccttc
gaaccgcgccgccaggaactgctgaaggcccgcgtcgcccgccaggcccgcatcgacgcc
ggcgagctgcccgacttcctgccggaaaccaagcacatccgcgaaggcgactggaaggtg
gcgccgctgccgaaggcgctggaatgccgccgcgtggaaatcaccggcccggtcgagcgc
aagatgatcatcaacgccttcaactcgggcgctgattcctacatgaccgacttcgaagat
tccaacagccccaactggtacaaccagatccagggccaggtgaacctgttcgacgcgatc
cgccgcgagatcagctacaccaacgaagccggcaaggtctacaagctcaacgacaagatc
gccaccctgcagatccgcccgcgcggctggcacctggacgagaagcacgtgctggtcgac
ggccagcgcgtctccggcggcatcttcgacttcgcgctggtgttcttccacaacgccaag
gaacagatcgcccgcggcgccggccccttctactacctgccgaagatggagtcgcacctc
gaagcccgcctgtggaacgacatcttcgtgatggcgcaggaccacatcggcctgccgcag
ggcaccatcaaggccaccgtgctggtcgaaaccatcctcgccaccttcgagatggaagag
atcctgtacgaactgcgcaaccactccgccgggctgaacgccgggcgctgggactacatc
ttctcctgcatcaagaagttcaagaagaacaaggacttctgcctcgccaaccgcggcgcc
atcacgatggaagtgcccttcatgcgctcctacgcgctggcgctggtgcaggcctgccac
aagcgcggcgccccggcgatgggcggcatgagcgcgctgatcccgatcaagagcgacccg
gtcgccaacgagaaggcgctggccggcatccgccacgacaagacccgcgacgccaacgac
ggctacgacggcggctgggtggcgcacccgggcctggtgccgatcgcgatggaagagttc
gtcaaggtgctgggcgacaagcccaaccagtgggaaaagcaggtgtccggcagcttcggc
ccgaaggactggatgaacttccagcctgagcagccgatcaccgaagtgggcgtccgcaac
aacatcaacgtcggcatccactacctcggcagctggctggccggcaacggctgcgtgccc
atccacaacctgatggaagacgccgccaccgccgaaatcagccgctcgcagatctggcag
tgggtggtgagcccgaagggcaagctggacgacggccgcaaggtcaccgccgacatggtg
cgcgcgatgattccggaagaactcgccaaggtgaaagccacagtgaccgcccagggcgag
aacaccgccacctacgaccaggccgcgacgatcttcgaagagatgtcgctgtcggagaac
ttccccgagttcctgaccctgccgctgtacgaagcgatggaataa

DBGET integrated database retrieval system