KEGG   Azoarcus sp. BH72: azo1159Help
Entry
azo1159           CDS       T00441                                 

Gene name
aceB
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
azo  Azoarcus sp. BH72
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    azo1159 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    azo1159 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    azo1159 (aceB)
Enzymes [BR:azo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     azo1159 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1247367..1248971)
Genome map
AA seq 534 aa AA seqDB search
MTATLDLPQGMQINAPLHPRFDQILTRDALELVAKLHRAFEPRRQELLKARVARQARIDA
GELPDFLPETKHIREGDWKVAPLPKALECRRVEITGPVERKMIINAFNSGADSYMTDFED
SNSPNWYNQIQGQVNLFDAIRREISYTNEAGKVYKLNDKIATLQIRPRGWHLDEKHVLVD
GQRVSGGIFDFALVFFHNAKEQIARGAGPFYYLPKMESHLEARLWNDIFVMAQDHIGLPQ
GTIKATVLVETILATFEMEEILYELRNHSAGLNAGRWDYIFSCIKKFKKNKDFCLANRGA
ITMEVPFMRSYALALVQACHKRGAPAMGGMSALIPIKSDPVANEKALAGIRHDKTRDAND
GYDGGWVAHPGLVPIAMEEFVKVLGDKPNQWEKQVSGSFGPKDWMNFQPEQPITEVGVRN
NINVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQIWQWVVSPKGKLDDGRKVTADMV
RAMIPEELAKVKATVTAQGENTATYDQAATIFEEMSLSENFPEFLTLPLYEAME
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccacgctcgacctgccgcaaggcatgcagatcaacgcgccgctgcatccgcgc
ttcgaccagatcctgacccgcgacgcgctggaactcgtcgccaagctgcaccgcgccttc
gaaccgcgccgccaggaactgctgaaggcccgcgtcgcccgccaggcccgcatcgacgcc
ggcgagctgcccgacttcctgccggaaaccaagcacatccgcgaaggcgactggaaggtg
gcgccgctgccgaaggcgctggaatgccgccgcgtggaaatcaccggcccggtcgagcgc
aagatgatcatcaacgccttcaactcgggcgctgattcctacatgaccgacttcgaagat
tccaacagccccaactggtacaaccagatccagggccaggtgaacctgttcgacgcgatc
cgccgcgagatcagctacaccaacgaagccggcaaggtctacaagctcaacgacaagatc
gccaccctgcagatccgcccgcgcggctggcacctggacgagaagcacgtgctggtcgac
ggccagcgcgtctccggcggcatcttcgacttcgcgctggtgttcttccacaacgccaag
gaacagatcgcccgcggcgccggccccttctactacctgccgaagatggagtcgcacctc
gaagcccgcctgtggaacgacatcttcgtgatggcgcaggaccacatcggcctgccgcag
ggcaccatcaaggccaccgtgctggtcgaaaccatcctcgccaccttcgagatggaagag
atcctgtacgaactgcgcaaccactccgccgggctgaacgccgggcgctgggactacatc
ttctcctgcatcaagaagttcaagaagaacaaggacttctgcctcgccaaccgcggcgcc
atcacgatggaagtgcccttcatgcgctcctacgcgctggcgctggtgcaggcctgccac
aagcgcggcgccccggcgatgggcggcatgagcgcgctgatcccgatcaagagcgacccg
gtcgccaacgagaaggcgctggccggcatccgccacgacaagacccgcgacgccaacgac
ggctacgacggcggctgggtggcgcacccgggcctggtgccgatcgcgatggaagagttc
gtcaaggtgctgggcgacaagcccaaccagtgggaaaagcaggtgtccggcagcttcggc
ccgaaggactggatgaacttccagcctgagcagccgatcaccgaagtgggcgtccgcaac
aacatcaacgtcggcatccactacctcggcagctggctggccggcaacggctgcgtgccc
atccacaacctgatggaagacgccgccaccgccgaaatcagccgctcgcagatctggcag
tgggtggtgagcccgaagggcaagctggacgacggccgcaaggtcaccgccgacatggtg
cgcgcgatgattccggaagaactcgccaaggtgaaagccacagtgaccgcccagggcgag
aacaccgccacctacgaccaggccgcgacgatcttcgaagagatgtcgctgtcggagaac
ttccccgagttcctgaccctgccgctgtacgaagcgatggaataa

DBGET integrated database retrieval system