KEGG   Azoarcus sp. BH72: azo1372Help
Entry
azo1372           CDS       T00441                                 

Gene name
pdhB
Definition
(GenBank) probable dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00010  Glycolysis / Gluconeogenesis
azo00020  Citrate cycle (TCA cycle)
azo00620  Pyruvate metabolism
azo01100  Metabolic pathways
azo01110  Biosynthesis of secondary metabolites
azo01120  Microbial metabolism in diverse environments
azo01130  Biosynthesis of antibiotics
azo01200  Carbon metabolism
Module
azo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    azo1372 (pdhB)
   00020 Citrate cycle (TCA cycle)
    azo1372 (pdhB)
   00620 Pyruvate metabolism
    azo1372 (pdhB)
Enzymes [BR:azo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     azo1372 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H PYNP_C HlyD_D23 RnfC_N
Motif
Other DBs
NCBI-ProteinID: CAL93989
RhizoBase: azo1372
UniProt: A1K584
Position
complement(1495116..1496804)
Genome map
AA seq 562 aa AA seqDB search
MSQLIEVKVPDIGDFDSVPVIELFVKVGDTIAVDDAIATLESDKATMDVPSSAAGVVKEV
LVKVGDKVSEGALLIKVEAAGAAAAAPAAAAAAPAPAPAPAAPAPAPAPAGAAPAAAGGV
VDVVVPDIGDFSDVPVIELFVKVGDTIKVDDAIATLESDKATMDVPSSAAGVVKEVLVKV
GDKVSQGSLLLKLESGAAAAAPASPPPLQGEGRGGDGVKPASNVPHPPPSLPLEGGGAKT
AAAPAAPSAVTLGGKVHASPSVRAFARELGVDLAQVKATGPKNRVLKEDVAAFIKGAMST
GVVPGKTPAAAAGASLGGGLDLLPWPKVDFAKFGEVEVKPLSRIKKISGQNLARNWVMIP
AVTYHEDADITDLEAFRVQMNKEYEKSGKKLTMLAFIIKASVRALQEFPEFNTSLDGDNL
VYKKYFNIAFAADTPNGLVVPVVKDADKKSVFQIAEETGALAKKARDGKLGPADMSGACF
TISSLGGIGGTYFAPIVNAPEVAILGVNKSVMKPVWDGKQFVPRLTLPMSLTADHRVIDG
ALATRFNVYLAQLLADFRRVML
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgagccaactcattgaagtgaaggttccggacatcggcgatttcgattcggtgccggtg
atcgaactgttcgtgaaggtcggcgacaccatcgccgtcgatgacgcgatcgccaccctg
gaatccgacaaagccaccatggacgtgccgtcctcggccgccggcgtggtcaaggaagtg
ctggtcaaggtcggcgacaaggtgtcggaaggtgcgctgctgatcaaggtcgaagccgct
ggcgccgctgccgctgcgcctgctgccgcggcagccgcccctgcgcccgctccggcaccc
gctgctcccgctcctgctccggccccggctggtgcagcgccggccgcggctggcggcgtg
gtcgacgtggtggtgcccgacatcggcgacttctccgacgtgccggtgatcgagctgttc
gtgaaggtgggcgacaccatcaaggtcgatgacgccatcgccacgctggaatcggacaag
gccaccatggacgtgccttcgtcggccgccggcgtggtcaaggaagtgctggtcaaggtc
ggcgacaaggtgtcgcagggcagcctgctgctgaagctggaaagcggcgctgccgccgct
gcaccggcttctccccctccccttcaaggggagggtcggggtggggatggggtcaagccg
gcctcgaacgtaccccatccccctcccagcctcccccttgaagggggaggggcaaaaact
gccgccgcgccagccgcgccctccgccgtcaccctcggcggcaaggtacacgccagcccg
tcggtgcgtgccttcgcccgcgaactcggcgtcgatctcgcccaggtcaaggccaccggc
ccgaagaaccgcgtcctcaaggaagacgtcgccgccttcatcaagggcgcgatgagcacc
ggcgtcgtcccgggcaagaccccggccgctgctgccggcgccagcctgggtggcggtctg
gatctgctgccgtggcccaaggtcgatttcgccaagtttggcgaggtcgaggtgaagccg
ctgtcccgcatcaagaagatctccggccagaacctcgcccgcaactgggtgatgatcccg
gcggtgacctatcacgaggatgccgacatcaccgatctggaagccttccgcgtccagatg
aacaaggaatacgagaagtccggcaagaagctcaccatgctcgccttcatcatcaaggcc
tcggtgcgcgcgctgcaggagttcccggagttcaacacctcgctcgacggtgacaacctc
gtctacaagaagtacttcaacatcgccttcgcggccgacacccccaacggcctggtcgta
ccggtggtgaaagacgcggacaagaagagcgtgttccagatcgccgaggaaaccggcgcg
ctcgccaagaaggcgcgcgacggcaagctcggtccggccgacatgtccggcgcgtgcttc
accatctcgtcgctgggcggcatcggtggcacctacttcgcgcccatcgtcaatgcgccc
gaagtggccatcctcggtgtgaacaagtcggtgatgaagccggtgtgggacggcaaacag
ttcgtgccgcgcctcaccctgccgatgtcgctgaccgccgaccaccgcgtgatcgacggc
gcgctcgccacccgcttcaacgtctacctcgcccaactgctggccgacttccgtcgggtc
atgctgtaa

DBGET integrated database retrieval system