KEGG   Azoarcus sp. BH72: azo1372Help
Entry
azo1372           CDS       T00441                                 

Gene name
pdhB
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
azo  Azoarcus sp. BH72
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:azo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:azo00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:azo00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:azo00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1495116..1496804)
Genome map
AA seq 562 aa AA seqDB search
MSQLIEVKVPDIGDFDSVPVIELFVKVGDTIAVDDAIATLESDKATMDVPSSAAGVVKEV
LVKVGDKVSEGALLIKVEAAGAAAAAPAAAAAAPAPAPAPAAPAPAPAPAGAAPAAAGGV
VDVVVPDIGDFSDVPVIELFVKVGDTIKVDDAIATLESDKATMDVPSSAAGVVKEVLVKV
GDKVSQGSLLLKLESGAAAAAPASPPPLQGEGRGGDGVKPASNVPHPPPSLPLEGGGAKT
AAAPAAPSAVTLGGKVHASPSVRAFARELGVDLAQVKATGPKNRVLKEDVAAFIKGAMST
GVVPGKTPAAAAGASLGGGLDLLPWPKVDFAKFGEVEVKPLSRIKKISGQNLARNWVMIP
AVTYHEDADITDLEAFRVQMNKEYEKSGKKLTMLAFIIKASVRALQEFPEFNTSLDGDNL
VYKKYFNIAFAADTPNGLVVPVVKDADKKSVFQIAEETGALAKKARDGKLGPADMSGACF
TISSLGGIGGTYFAPIVNAPEVAILGVNKSVMKPVWDGKQFVPRLTLPMSLTADHRVIDG
ALATRFNVYLAQLLADFRRVML
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgagccaactcattgaagtgaaggttccggacatcggcgatttcgattcggtgccggtg
atcgaactgttcgtgaaggtcggcgacaccatcgccgtcgatgacgcgatcgccaccctg
gaatccgacaaagccaccatggacgtgccgtcctcggccgccggcgtggtcaaggaagtg
ctggtcaaggtcggcgacaaggtgtcggaaggtgcgctgctgatcaaggtcgaagccgct
ggcgccgctgccgctgcgcctgctgccgcggcagccgcccctgcgcccgctccggcaccc
gctgctcccgctcctgctccggccccggctggtgcagcgccggccgcggctggcggcgtg
gtcgacgtggtggtgcccgacatcggcgacttctccgacgtgccggtgatcgagctgttc
gtgaaggtgggcgacaccatcaaggtcgatgacgccatcgccacgctggaatcggacaag
gccaccatggacgtgccttcgtcggccgccggcgtggtcaaggaagtgctggtcaaggtc
ggcgacaaggtgtcgcagggcagcctgctgctgaagctggaaagcggcgctgccgccgct
gcaccggcttctccccctccccttcaaggggagggtcggggtggggatggggtcaagccg
gcctcgaacgtaccccatccccctcccagcctcccccttgaagggggaggggcaaaaact
gccgccgcgccagccgcgccctccgccgtcaccctcggcggcaaggtacacgccagcccg
tcggtgcgtgccttcgcccgcgaactcggcgtcgatctcgcccaggtcaaggccaccggc
ccgaagaaccgcgtcctcaaggaagacgtcgccgccttcatcaagggcgcgatgagcacc
ggcgtcgtcccgggcaagaccccggccgctgctgccggcgccagcctgggtggcggtctg
gatctgctgccgtggcccaaggtcgatttcgccaagtttggcgaggtcgaggtgaagccg
ctgtcccgcatcaagaagatctccggccagaacctcgcccgcaactgggtgatgatcccg
gcggtgacctatcacgaggatgccgacatcaccgatctggaagccttccgcgtccagatg
aacaaggaatacgagaagtccggcaagaagctcaccatgctcgccttcatcatcaaggcc
tcggtgcgcgcgctgcaggagttcccggagttcaacacctcgctcgacggtgacaacctc
gtctacaagaagtacttcaacatcgccttcgcggccgacacccccaacggcctggtcgta
ccggtggtgaaagacgcggacaagaagagcgtgttccagatcgccgaggaaaccggcgcg
ctcgccaagaaggcgcgcgacggcaagctcggtccggccgacatgtccggcgcgtgcttc
accatctcgtcgctgggcggcatcggtggcacctacttcgcgcccatcgtcaatgcgccc
gaagtggccatcctcggtgtgaacaagtcggtgatgaagccggtgtgggacggcaaacag
ttcgtgccgcgcctcaccctgccgatgtcgctgaccgccgaccaccgcgtgatcgacggc
gcgctcgccacccgcttcaacgtctacctcgcccaactgctggccgacttccgtcgggtc
atgctgtaa

DBGET integrated database retrieval system