KEGG   Azoarcus sp. BH72: azo1394Help
Entry
azo1394           CDS       T00441                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
azo  Azoarcus sp. BH72
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    azo1394 (tpiA)
   01230 Biosynthesis of amino acids
    azo1394 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    azo1394 (tpiA)
   00051 Fructose and mannose metabolism
    azo1394 (tpiA)
   00562 Inositol phosphate metabolism
    azo1394 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    azo1394 (tpiA)
Enzymes [BR:azo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     azo1394 (tpiA)
Exosome [BR:azo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   azo1394 (tpiA)
  Exosomal proteins of bladder cancer cells
   azo1394 (tpiA)
  Exosomal proteins of melanoma cells
   azo1394 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1523592..1524320
Genome map
AA seq 242 aa AA seqDB search
MTTKLIAGNWKLNGSLAKNAALIDELRRAEMHCVVCVPYPYLAQAQALVAGSLIELGAQD
VSEYEQGAYTGEVSAAMLVEFGCRYVIVGHSERRALFGDSDQVVGRKAASALAAGLTPIV
CVGETLAERELGEVEAVIRRQLQAVADCVGGEALPTLVVAYEPVWAIGTGRSATPEQVAQ
THGFIRAWFSARCDASAVRILYGGSVKPENAAVLFSTDDVDGGLIGGASLVGSDFVAICR
AA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgaaactgatagcaggcaactggaagctcaacggcagcctggcgaagaacgca
gcgctgatcgacgagttgcggcgcgccgagatgcactgcgtcgtttgtgtgccgtatccg
tatctggcccaggcgcaggcgcttgttgccgggtcgttgatcgaactcggtgcccaggac
gtcagcgagtatgagcagggcgcctataccggcgaagtttccgccgcgatgctcgtcgag
ttcggctgccggtatgtcatcgtcggtcactccgaacgccgcgcgttgtttggagattcc
gaccaggtcgtcggccgcaaggcggcctctgcgcttgccgccgggctcacgcccatcgtc
tgcgtgggtgaaacgctggcggagcgcgagcttggggaagtcgaagcggtcatccgccgt
caactgcaagccgttgccgattgcgtagggggcgaggcgctgccgacgttggtggtcgct
tacgagccggtgtgggccattggcaccggccgctcggctacgccggagcaggtcgcgcag
acgcacggcttcatccgcgcatggttttcggcccgctgcgacgcttcggctgtgcgcatc
ctttatggcggcagtgtcaagcccgaaaatgcggcggtgctgttctccacggacgacgtc
gatggcggcctgatcggcggggcttcgctggtcggtagcgacttcgttgccatctgccgc
gccgcctga

DBGET integrated database retrieval system