KEGG   Azoarcus sp. BH72: azo1394Help
Entry
azo1394           CDS       T00441                                 

Gene name
tim
Definition
(GenBank) putative triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00010  Glycolysis / Gluconeogenesis
azo00051  Fructose and mannose metabolism
azo00562  Inositol phosphate metabolism
azo00710  Carbon fixation in photosynthetic organisms
azo01100  Metabolic pathways
azo01110  Biosynthesis of secondary metabolites
azo01120  Microbial metabolism in diverse environments
azo01130  Biosynthesis of antibiotics
azo01200  Carbon metabolism
azo01230  Biosynthesis of amino acids
Module
azo_M00002  Glycolysis, core module involving three-carbon compounds
azo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    azo1394 (tim)
   00051 Fructose and mannose metabolism
    azo1394 (tim)
   00562 Inositol phosphate metabolism
    azo1394 (tim)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    azo1394 (tim)
Enzymes [BR:azo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     azo1394 (tim)
Exosome [BR:azo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   azo1394 (tim)
  Exosomal proteins of bladder cancer cells
   azo1394 (tim)
  Exosomal proteins of melanoma cells
   azo1394 (tim)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAL94011
RhizoBase: azo1394
UniProt: A1K5A6
Position
1523592..1524320
Genome map
AA seq 242 aa AA seqDB search
MTTKLIAGNWKLNGSLAKNAALIDELRRAEMHCVVCVPYPYLAQAQALVAGSLIELGAQD
VSEYEQGAYTGEVSAAMLVEFGCRYVIVGHSERRALFGDSDQVVGRKAASALAAGLTPIV
CVGETLAERELGEVEAVIRRQLQAVADCVGGEALPTLVVAYEPVWAIGTGRSATPEQVAQ
THGFIRAWFSARCDASAVRILYGGSVKPENAAVLFSTDDVDGGLIGGASLVGSDFVAICR
AA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgaaactgatagcaggcaactggaagctcaacggcagcctggcgaagaacgca
gcgctgatcgacgagttgcggcgcgccgagatgcactgcgtcgtttgtgtgccgtatccg
tatctggcccaggcgcaggcgcttgttgccgggtcgttgatcgaactcggtgcccaggac
gtcagcgagtatgagcagggcgcctataccggcgaagtttccgccgcgatgctcgtcgag
ttcggctgccggtatgtcatcgtcggtcactccgaacgccgcgcgttgtttggagattcc
gaccaggtcgtcggccgcaaggcggcctctgcgcttgccgccgggctcacgcccatcgtc
tgcgtgggtgaaacgctggcggagcgcgagcttggggaagtcgaagcggtcatccgccgt
caactgcaagccgttgccgattgcgtagggggcgaggcgctgccgacgttggtggtcgct
tacgagccggtgtgggccattggcaccggccgctcggctacgccggagcaggtcgcgcag
acgcacggcttcatccgcgcatggttttcggcccgctgcgacgcttcggctgtgcgcatc
ctttatggcggcagtgtcaagcccgaaaatgcggcggtgctgttctccacggacgacgtc
gatggcggcctgatcggcggggcttcgctggtcggtagcgacttcgttgccatctgccgc
gccgcctga

DBGET integrated database retrieval system