KEGG   Azoarcus sp. BH72: azo1456Help
Entry
azo1456           CDS       T00441                                 

Gene name
cheB2
Definition
protein glutamate-methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
azo  Azoarcus sp. BH72
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:azo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    azo1456 (cheB2)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    azo1456 (cheB2)
Enzymes [BR:azo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     azo1456 (cheB2)
Two-component system [BR:azo02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   azo1456 (cheB2)
Bacterial motility proteins [BR:azo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    azo1456 (cheB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1588263..1589384
Genome map
AA seq 373 aa AA seqDB search
MPIRVLICDDSAVMRALLADIVAREPDMEVVGTAADALVAREMIRNSKPDVLTLDVEMPQ
MDGLEFLNRLMRLHPMAVVMISNLTERGSEASLRALELGALEIVGKPQARSAEALAEYGA
ALVERIRAAHLAWSRASERGRVMSPRPAPAVAAAPALAVSTVAPEARARAVAPTMPAAPR
RLGQRISAIFIGASTGGTEAIKEVLLGLPVGMPPIMIVQHMPEMFTASFARRLDGLCALD
VREAESGERLEPGRVYLAPGHSHLSVRRAGTGYQCELSRAEPVNRHRPAVDVLFNSAAAE
VGAGALGVLLTGMGKDGAAGLKAMRDAGAWTIAQDQESCVVYGMPREAVALGAAQQVLPL
REIGAALVQRCSV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgccgatccgcgtcctgatctgcgacgactccgccgtgatgcgtgccctgctggccgac
atcgtcgcgcgcgagccggacatggaagtcgtcggcaccgccgcggatgcactggtggcg
cgcgagatgatccgcaacagcaagccggacgtgctgacgctggatgtggagatgccgcag
atggacgggctggaattcctcaaccgcttgatgcgcctgcatccgatggcggtggtgatg
atctccaacctcaccgagcgcggctccgaggcgtcgctgcgggcgctggaactgggcgcg
ctggagatcgtcggcaagccgcaggcccgcagcgccgaggcgctggccgagtacggtgcg
gcgctggtggagcgcatccgcgcggcgcatctggcgtggtcgcgcgccagcgagcggggc
cgggtgatgtcgccgcgtcccgcgcccgcggtggccgcggcacctgcactggcggtttcc
accgtcgccccggaagcgcgcgcgcgcgcggtggcgcctacgatgccggcggcgccgcgc
cggctcggccagcggatcagcgcgatcttcatcggcgcctccaccggcgggacggaggcg
atcaaggaagtcctgctcggcctgccggtgggcatgccgccgatcatgatcgtccagcac
atgccggagatgttcaccgcgtcattcgcacgccggctcgacgggctgtgcgcgctcgac
gtgcgcgaggcggaatccggcgagcggctggagccgggacgggtctacctcgcgccgggc
cactcccacctgtcggtgcggcgcgccggcaccggctaccagtgcgagctgtcgcgcgcg
gagccggtgaaccgccaccggccggccgtggatgtgctgttcaattccgccgcggcggag
gtgggcgccggcgcgctcggcgtgttgctgaccggcatgggcaaggatggcgcggccggg
ctgaaggcgatgcgcgacgccggtgcgtggaccatcgcccaggaccaggagtcctgcgtg
gtgtatggcatgccgcgcgaggcggtggcgctcggcgcggcccagcaggtgctgccgctg
cgcgagatcggcgccgcgctggtacagcgttgcagcgtctga

  All links  
No link information was found.   
DBGET integrated database retrieval system