KEGG   Azoarcus sp. BH72: azo1474Help
Entry
azo1474           CDS       T00441                                 

Gene name
pfkA
Definition
(GenBank) putative 6-phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
azo  Azoarcus sp. BH72
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    azo1474 (pfkA)
   00030 Pentose phosphate pathway
    azo1474 (pfkA)
   00051 Fructose and mannose metabolism
    azo1474 (pfkA)
   00052 Galactose metabolism
    azo1474 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    azo1474 (pfkA)
Enzymes [BR:azo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     azo1474 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     azo1474 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
1605395..1606660
Genome map
AA seq 421 aa AA seqDB search
MSPTQPFNLLYAQAGGVTAVINASAAAVIEAAREHPQAIGTVYGARNGILGVLSETLVDT
TPLTPAELAQLALTPGGAFGSCRFDLDPAEANPAQYDRLFEVFASYRIGAFLYNGGNGSM
DIVARVAAAARARAYPLCCIGVPKTVDNDLEGTDCSPGFGSAAKYLATAMRESGLDLAAM
SSRRGRVFVMEVMGRNAGWLAAATALAARNEDEPPHIVLLPEVAFDEEAFLARVKAVVER
LGYCAVTVAEGIRRADGTLVMEQSHDALGHVQLGGAGQCVARLVSARFDYKHHWAIPDYL
QRAAGHWRSATDVAQARAVGRAAVAYALAGQDGVMPAIRRLADEPYRWDVQPVRVEEIAN
LERRVPPHFIAADGLHVTAAAKAALAPLIEGELPVPTHAGLPDYFQLQLAPQPRRLPAWT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgacccagccgttcaatctcctctacgcccaggcgggcggcgtcaccgcggtg
atcaacgcgagcgctgccgcggtcatcgaagccgcgcgcgaacatccgcaggcgatcggc
actgtctatggcgcgcgcaacggcattctcggggtgctgagtgaaacgctggtcgatacg
acgccgctgacgcccgccgagctggcacagcttgcactcacgcccggcggcgcattcggt
tcgtgccgcttcgacctcgatccggcggaagccaatcccgcgcagtacgaccgtctgttc
gaggtgttcgccagctatcgcatcggcgccttcctgtacaacggcggcaacggttccatg
gacatcgtcgcccgcgttgccgcagcggcgcgcgcgcgggcttacccgctgtgctgcatc
ggtgtgcccaagacggtggacaacgacctcgagggcaccgactgctcgcccggcttcggc
tccgcggccaagtatctcgccaccgcgatgcgcgagtccgggctggatttggcggcgatg
tccagccggcgtgggcgggtgttcgtcatggaagtgatggggcgcaacgccggctggctg
gctgccgccaccgcgctggccgcgcgcaacgaggacgagccgccgcacatcgtgctgctg
cccgaggtcgcgttcgacgaggaggccttcctcgcgcgggtgaaggcggtggtcgagcgc
ctgggctactgcgcagtcaccgtggcggaaggcatccgccgcgccgacggcacgctggtg
atggagcagtcgcacgacgcgctcggtcacgtccagttgggcggcgcggggcagtgcgtc
gcgcgcttggtttcggcgcgcttcgactacaagcaccactgggccatcccggactacctg
cagcgcgcggccggccactggcgctcggccaccgacgtggcgcaggcaagggcggtgggg
cgggctgcggtggcctacgcgctggccgggcaggatggggtgatgccggcgatccgccgc
ctggcggacgaaccgtatcggtgggatgtgcagccggtgcgggtggaggagatcgccaac
ctcgagcgccgcgtgccgccgcatttcatcgccgccgacggcctgcacgtcaccgccgcc
gccaaggccgcgctggcgccgctgatcgaaggcgaactgccggtgccgacccacgccggt
ctgcccgactacttccaactgcaactcgcaccccaaccgcgccggctgcctgcctggacg
cgctga

DBGET integrated database retrieval system