KEGG   Azoarcus sp. BH72: azo1556Help
Entry
azo1556           CDS       T00441                                 

Gene name
odhB
Definition
(GenBank) dihydrolipoamide S-succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00020  Citrate cycle (TCA cycle)
azo00310  Lysine degradation
azo01100  Metabolic pathways
azo01110  Biosynthesis of secondary metabolites
azo01120  Microbial metabolism in diverse environments
azo01130  Biosynthesis of antibiotics
azo01200  Carbon metabolism
Module
azo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
azo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    azo1556 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    azo1556 (odhB)
Enzymes [BR:azo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     azo1556 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: CAL94173
RhizoBase: azo1556
UniProt: A1K5R8
Position
1706183..1707385
Genome map
AA seq 400 aa AA seqDB search
MLIEVKVPQLSESVSEATLVTWHKKEGDAVTRDENLIDIETDKVVLETPAPADGVLVKII
KGDGGTVTSGELIAQIDTEAKAAAGGAKAAEPVQAVTPPPAAPAAAPSAAAGAASPAARK
ILEEKGIAAGDVAGSGRGGRVTKEDAVGASAKPAAAAAAAPAVVIAGERPEERVPMTRLR
ARIAERLLQSKNENAILTTFNEVNMAPVMALRKQYGDKFEKAHGVRLGFMGFFVKAAVAA
LKKFPILNASVDGNDIVYHGYIDIGIAVGSPRGLVVPILRDAESMSIADIEKKIAEFGQK
AKDGKLSLEELSGGTFSISNGGVFGSMLSTPIINPPQSAILGIHATKDRPVVENGQIVIR
PINYLAMSYDHRIIDGREAVLGLVTMKEALEDPARLILDV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcgaagtgaaagtgccgcagctgtccgagtccgtttccgaagccacgctggtc
acctggcacaagaaggaaggcgacgcggtcacccgtgacgagaacctgatcgacatcgag
accgacaaggtcgtgctggaaaccccggccccggccgatggcgtgctggtcaagatcatc
aagggcgacggcggcactgtgacgtccggcgaactgatcgcccagatcgacaccgaagcc
aaggccgccgccggcggcgccaaggccgcggagcccgtgcaggcggtgaccccgccgccg
gccgcccccgctgccgcgccgtccgccgctgctggcgccgccagcccggctgcgcgcaag
atccttgaagagaagggcatcgccgcgggcgacgtggccggctccggccgtggcggccgc
gtcaccaaggaagacgccgtgggcgccagcgccaagccggcggctgccgctgctgcggcc
ccggccgtggtgatcgccggcgagcgtccggaagagcgcgtgccgatgacccgcctgcgc
gcccgcatcgccgagcgcctgctgcagtcgaagaacgagaacgccatcctcaccacgttc
aacgaagtgaacatggccccggtgatggcgctgcgcaagcagtacggcgacaagttcgag
aaggcccacggcgtgcgcctgggcttcatgggcttcttcgtcaaggccgccgtggccgcg
ctgaagaagttcccgatcctgaacgcctcggtcgatggcaacgacatcgtctaccacggc
tacatcgacatcggcatcgcggtcggttcgccgcgtggcctggtcgtgccgatcctgcgt
gacgccgaatcgatgtcgatcgccgacatcgagaagaagatcgccgagttcggccagaag
gccaaggacggcaagctgtcgctggaagaactctccggcggcaccttctcgatctccaac
ggtggcgtgttcggttcgatgctgtcgaccccgatcatcaacccgccgcagtccgccatc
ctcggcatccacgccaccaaggaccgtccggtggtcgagaacggccagatcgtgatccgc
ccgatcaactacctggcgatgtcctacgaccaccgcatcatcgacggccgcgaagcggtg
ctcggcctggtgacgatgaaggaagcgctggaagatccggcccgcctgatcctcgacgtc
taa

DBGET integrated database retrieval system